SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011162 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011162
Domain Number 1 Region: 1104-1243,1300-1588
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.83e-110
Family Myotubularin-like phosphatases 0.00000537
Further Details:      
 
Domain Number 2 Region: 1643-1846
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-31
Family Pleckstrin-homology domain (PH domain) 0.0000235
Further Details:      
 
Domain Number 3 Region: 875-1017
Classification Level Classification E-value
Superfamily PH domain-like 2.17e-17
Family GRAM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011162   Gene: ENSCAFG00000007500   Transcript: ENSCAFT00000012037
Sequence length 1849
Comment pep:known_by_projection chromosome:CanFam3.1:21:33005489:33461794:-1 gene:ENSCAFG00000007500 transcript:ENSCAFT00000012037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLADYFIVVGYDHEKPGSGAGLGKIIQRFPQKDWDDTPFPQGIELFCQPGGWQLSKER
KQPTFFVVVLTDIDSDRHYCSCLTFYEAEINLQGTKKEEIEGEVEVSGLIQPAEVFAPKS
LVLVSRLDYPEIFRACLGLIYTVYVDSLNVSLESLIANLCACLVPAAGGSQKLFSLGAGD
RQLIQTPLHDSLPVTGTSVALLFQQLGIQNVLSLFCAVLTENKVLFHSASFQRLSDACRA
LESLMFPLKYSYPYIPILPAQLLEVLSSPTPFIIGVHSIFKTDIHELLDVIIADLDGGTI
KIPECIHLSSLPEPLLHQTQAALSLILHPDLEVADHAFPPPRTALSHSKMLDKEVRAVFL
RLFAQLFQGYRSCLQLIRIHAEPVIHFHKTAFLGQRGLVENDFLTKVLNGMAFAGFVSER
GPPYRSCDLFDELVAFEVERIKVEENNPLKIIKHVRELAEQLFKNENPNPHMAFQKVPRP
TEGSHLRVHILPFPKINETRVQELIQENLAKNQNAPPASRVEKKCVVPAGPPVVSIMDKV
TTVFNSAQRLEVVRNCISFIFENKTLETEKTLPAALRALKGKAARQCLTDELGLHVQQNR
AILDHQQFDYIIRMMNCTLQDCSSLEEYNIAAALLPLTSAFYRKLAPGVSQFAYTCVQDH
PIWTNQQFWETTFYNAVQEQVRSLYLSAKEDNHAPYLKQKDKLPDDQYQEKTAMDLAAEQ
LRLWPSLSKSTQQELVQREESTVFSQAIHFANLMVNLLVPLDTSKNKLLRTSAPGDWESG
SNSIVTNSIAGSVAESYDTESGFEDSENNDIANSVVRFITRFIDKVCTESGVTQDHIKSL
HCMIPGIVAMHIETLEAVHRESRRLPPIQKPKILRPSLLPGEEIICEGLRVLLDPDGREE
ATGGLLGGPQLLPAEGALFLTTYRILFRGTPHDQLVGEQTVVRSFPIASITKEKKITMQN
QLQQNMQEGLQITSASFQLIKVAFDEEVSPEVVEIFKKQLMKFRYPQSIFTTFAFAAGQT
TPQIILPKQKEKNTSFRTFSKTIVKGAKRAGKMTIGRQYLLKRRTGTIVEERVNRPGWNE
EDDISVSDDSELPTSTTLKASEKSTMEQLVEKACFRDYQRLGLGTISGSSSRSKPEYFRI
TASNRMYSLCRSYPGLLVVPQAVQDSSLPRVARCYRHNRLPVVCWKNSRSGTLLLRSGGF
HGKGVVGLFKSQNSPQAAPTSSLESSSSIEQEKYMQALLNAVSVHQKLSGSNTLTVRPAL
ALSPGVWASLRSSTRLISSPTSFIDVGARLAGRDHSASFSNSTYLQNQLSKRQAALYIFG
EKSQLRNFKLEFALNCEFVPVEFYDIRQVKASFKKLMRACVPSTIPTDSEVTFLKALGDS
EWFPQLHRIMQLAVVVSEVLENGSSVLVCLEEGWDITAQVTSLVQLLSDPFYRTLEGFRM
LVEKEWLSFGHKFNQRSSLTLNCQGSGFTPVFLQFLDCVHQVHNQYPTEFEFNLYYLKFL
AFHYVSNRFKTFLLDSDYERLEHGTLFDDKGDKHAKKGICIWECIDRMHKRSPIFFNYLY
SPVELEALKPNVNVSSLKKWDYYIEETLSTGPSYDWMMLTPKQFPSEDSEVAGGAGPQSQ
RRTVWPCYDDISCAQPDALTSLFSEIERLEHKLNQTPEKWQQLWERVTMDLKEESRADRP
QRHPSGSPGIVSTNLPSCQKRSLLHLPDSSAGQEHSTSVSPSNGVDRRAATLYSQYASKN
DENRSFEGTLYKRGALLKGWKPRWFVLDVTKHQLRYYDSGEDTSCKGHIDLAEVEMVIPA
GPSMGAPKHTSDKAFFDLKTSKRVYNFCAQDGQSAQQWMDRIQSCISDA
Download sequence
Identical sequences F1PZ30
XP_534052.3.84170 ENSCAFP00000011162 ENSCAFP00000011162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]