SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011293 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011293
Domain Number 1 Region: 146-275
Classification Level Classification E-value
Superfamily Cyclin-like 3.67e-52
Family Cyclin 0.000000356
Further Details:      
 
Domain Number 2 Region: 10-144
Classification Level Classification E-value
Superfamily Cyclin-like 7.78e-45
Family Cyclin 0.000000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011293   Gene: ENSCAFG00000007614   Transcript: ENSCAFT00000012181
Sequence length 313
Comment pep:known_by_projection chromosome:CanFam3.1:1:121687958:121697516:-1 gene:ENSCAFG00000007614 transcript:ENSCAFT00000012181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSRASPLPLLNWANRDEVWKIMLNKEKTYLRDKHFMQRHPLLQPKMRAILLDWLMEVCE
VYKLHRETFYLAQDFFDRYMATQQNIVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVT
DGACSGEEILSMELIIMKALKWHLSPLTIVSWLNVYMQVAYLNDLYEVLLPQYPQQIFIQ
IAELLDLCVLDVGCLEFPYGVLAASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAMV
IRETGSSKLKHFRGVPAEDAHNIQTHINSLDLLDKAQAKKAILSEQNRISPPPTGVLTPP
QSSKKQSSGQDTA
Download sequence
Identical sequences F1Q3X7
ENSCAFP00000011293 ENSCAFP00000011293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]