SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011302 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011302
Domain Number 1 Region: 13-133
Classification Level Classification E-value
Superfamily PH domain-like 3.6e-28
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 2 Region: 148-215
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.67e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011302   Gene: ENSCAFG00000007627   Transcript: ENSCAFT00000012193
Sequence length 283
Comment pep:known_by_projection chromosome:CanFam3.1:1:121781181:121782032:-1 gene:ENSCAFG00000007627 transcript:ENSCAFT00000012193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDYLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFND
ILVYGSIVLSKRKYRGQHIIPLEEVTLEPLPETLQAKNRWMIKTAKKSFVVSAASTTERQ
EWISHIEECVRRQLLATGRPPSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGF
VVCAECSRERFLLPRLSPKPLRVCSLCYRELAARKREEEEEGGGPGGGGAPGQPRAYLGG
AECGASSGDDEDSDEDKEGGGDGDWPSHVEFYASGVSWSAFHG
Download sequence
Identical sequences E2R1B7
ENSCAFP00000011302 XP_005616855.1.84170 XP_005616856.1.84170 XP_005616857.1.84170 XP_005616858.1.84170 XP_005616859.1.84170 XP_013976419.1.84170 XP_013976425.1.84170 XP_541726.2.84170 ENSCAFP00000011302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]