SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011335 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011335
Domain Number 1 Region: 8-235
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.13e-59
Family DBL homology domain (DH-domain) 0.0000161
Further Details:      
 
Domain Number 2 Region: 221-362
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-34
Family Pleckstrin-homology domain (PH domain) 0.00067
Further Details:      
 
Domain Number 3 Region: 382-492
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.8e-28
Family DEP domain 0.003
Further Details:      
 
Domain Number 4 Region: 477-606
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.3e-28
Family DEP domain 0.0011
Further Details:      
 
Domain Number 5 Region: 677-743
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000237
Family PDZ domain 0.017
Further Details:      
 
Domain Number 6 Region: 581-673
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000736
Family PDZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011335   Gene: ENSCAFG00000007620   Transcript: ENSCAFT00000012231
Sequence length 1605
Comment pep:known_by_projection chromosome:CanFam3.1:29:17458082:17734659:1 gene:ENSCAFG00000007620 transcript:ENSCAFT00000012231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDESRGDCRAESAKDLEKQLRLRVCVLSELQMTERDYVGTLEFLVSAFLHRMNQCAASK
IDKNVTEETVKMLFSNIEDILAVHKEFLKVVEECLHPEPNAQQEVGTCFLHFKDKFRIYD
EYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLLL
KELLKRTPRKHSDYAAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNIT
DTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGHRYLFRGRI
NTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKHEWFEAILKER
ERRKGLKLGMEQDTWVMISEQGEKLYKMMCKQGNLIKDRKRKLTTFPKCFLGSEFVSWLL
EIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPRNEMQDVIS
KGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGVGLC
DNGFMHHVLEKSEFKDEPLLFRFFSDEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSNE
GSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCL
NSRKPLRVLVSTKPRETVKIPDSAEGLGFQIRGYGPSVVHAVGRGTVAAAAGLHPGQCII
KVNGINVSKETHASVIAHVTACRKYRRPMKQDSIQWVYNSIESAQEDLQKSNSKPPGDEV
GDAFDCKVEEVIDKFNTMAIIDGKKEHVSLTVDNVHLEYGVVYEYDSTAGIKCNVVEKMI
EPKGFFSLTAKILEALAKSDDYFVQNCTSLNSLNEVIPTDLQSKFSAICSEKIEHICQRI
SSYKKFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHVNIMEVSYPKTSTSLGSAFGV
QLDSRKHNSHDKENKSEQGKLSPMVYIQHTITTMAAPSGLSLGQQDGHGLRYLLKEEDLE
TQDIYQKLLGKLQTALKEVEMCVCQIDDLLSSITYSPKLERKTSECIVPPDSDNEKGERN
SKRVCFNMAGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSQCSSYFHSDEMDSG
DELPLSVRISHDKQDKIHSCLEHLFSQVDSITNLLKGQAVVRAFEQTKYLTPGQGLQEFQ
QEMELKLSCPKRLRLHIKQDPWNLPSSVRNLAQNIRKFVEEVKCRILLALLEYSDSETQL
RRDMVFCQSLVATVCAFSEQLMAALNQMFDNSKDNEMDTGEASRRWLDQIANAGVLFHFQ
SLLSPNLTDEQAMLEDTLVALFDLEKVSFYFKPSEEEPLVANVPLTYQAEGSRQALKVYF
YIDSYHFEQLPQRLKNGGGFKIHPVLFAQALESMEGYYYRDNVSVEEFQAQINAASLEKV
KQYNQKLRAFYLDKSNSPPNSTSKAAYVDKLMRPLNALDELYRLVASFIRSKRTAACANT
ACSASGVGLLSVSSELCNRLGACHIIMCNSGVHRCTLSVTLEQAIILARSHGLPPRYIMQ
ATDVMRKQGARVQNTAKNLGIRDRTPQSAPRLYKLCEPPPPVGEE
Download sequence
Identical sequences E2R0G2
ENSCAFP00000011335 ENSCAFP00000011335 XP_544113.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]