SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011342 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011342
Domain Number 1 Region: 26-115
Classification Level Classification E-value
Superfamily WWE domain 1.08e-29
Family WWE domain 0.00087
Further Details:      
 
Domain Number 2 Region: 330-433
Classification Level Classification E-value
Superfamily RING/U-box 8.67e-20
Family RING finger domain, C3HC4 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000011342
Domain Number - Region: 5-36
Classification Level Classification E-value
Superfamily WWE domain 0.00687
Family WWE domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011342   Gene: ENSCAFG00000007651   Transcript: ENSCAFT00000012238
Sequence length 560
Comment pep:known_by_projection chromosome:CanFam3.1:18:37539218:37570939:-1 gene:ENSCAFG00000007651 transcript:ENSCAFT00000012238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRLAPYIIDLQSITFRQDTGTLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGI
TIQHAYEKQHPWIDLTPIGFSYVIDFSTMGQINRQTQRQRRVRRRLDLVYPMVTGTLAKA
QSWPASPASAPAPAAPACSCPQCVLVMSVKAAVAHGSTAPLQPPAARKNLPPAPGPGAKS
PDGLGTIRAPVRTVPSQAIRRQASSTPAGGTVGSPASPPGANGKTGRVALATLNRTNLQR
LAIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPP
PVSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPDEDCTICMERLTAP
SGYKGLQPTVKPDLVGKLSRCGHIYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQP
PGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEK
GRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDN
VLAELAAQGISEDSTAQEKD
Download sequence
Identical sequences F1Q2G5
ENSCAFP00000011342 ENSCAFP00000011342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]