SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011548 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011548
Domain Number 1 Region: 5-291
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.36e-74
Family BAR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 397-576
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.000000325
Further Details:      
 
Domain Number 3 Region: 691-785
Classification Level Classification E-value
Superfamily SH3-domain 1.01e-16
Family SH3-domain 0.00016
Further Details:      
 
Domain Number 4 Region: 264-368
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-16
Family Pleckstrin-homology domain (PH domain) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011548   Gene: ENSCAFG00000007789   Transcript: ENSCAFT00000012463
Sequence length 786
Comment pep:known_by_projection chromosome:CanFam3.1:15:46070475:46381464:1 gene:ENSCAFG00000007789 transcript:ENSCAFT00000012463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLIAATKSLSAAQRKF
AHSLRDFKFEFIGDAETDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFR
KEQLGAVKEEKKKFDKETEKNYSLIDKHLNLSAKKKDSHLQEADIQVEQNRQHFYELSLE
YVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELAKDFNHYKMELQINIQNTRNRFE
GTRSEVEELMNKIRQNPKDHKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCMYRKAAKKF
NIIPFEHRSGGKLGDGEVFFLKECTKRHTDSIDRRFCFDVEAADRPGVALTMQAFSEEER
KQWLEALGGKEALLHSFNRAIIPRPEGSAQLDKMGFTILRKCISAVETRGINDQGLYRVV
GVSSKVQRLLSMLLDVKTCNEVDLENSIDWEVKTITSALKQYLRSLPEPLMTYELHGDFI
VPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGP
TLMRPQEETVAAIMDLKFQNIVVEILIENHEKIFRTLPDATFPEPIPLSTSPPNAPPRQS
KRQGQRTKRPVAVYNLCLELEDGDSPNLTKEDTPTSNLDSLSSPSPMTAAVHRPPGPDKN
HLLADGGSFGDWASPGPCQMRSPMVQWLNMQSPASPSCSPAVTPPSPKPPPSPLSLSATV
VDKPPESIVNRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQ
NYVKLL
Download sequence
Identical sequences E2R3X1
ENSCAFP00000011548 XP_539757.2.84170 ENSCAFP00000011548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]