SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011583 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011583
Domain Number 1 Region: 110-485
Classification Level Classification E-value
Superfamily Serpins 1.44e-75
Family Serpins 0.0000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011583   Gene: ENSCAFG00000007838   Transcript: ENSCAFT00000012508
Sequence length 487
Comment pep:known_by_projection chromosome:CanFam3.1:18:38570607:38580831:-1 gene:ENSCAFG00000007838 transcript:ENSCAFT00000012508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPSCCECLRGELCLIVGKVLEPQVRASSDLNVTSPNSMAESWQGGSEGHISEGAITKNVS
TQHTVDSSTLLNISSTIVTANTTLEPTTQPFIGSTVQPTQPTTEPFCPGPATSCSDAESH
WAESELSEALIAFSLKLYHAFSAVKKVETNMAFSPFSIASLLTQVLLGAGENTKRNLENL
LSYPEDFACVHQALKAFTSKGFTSVSQIFHSPDLPIRDTFVNASQSLYGSSPRVLGNDSN
VNVELINTWVAEKTNHKITELLESLPSDTRLVLLNAVYLSAKWKTTFDPKRTSLEPFYLK
SSVIKAFMMNSKKYPVAHFTDSTLKAKVLQLILVYNHFLLVLLKKGLKGRLGSVCDNILG
QVTRGVLDTSSVGTFHNTQLPHGTIKITSLSVTELDLLIGYALEFFDFLYDLNLCGLTED
IDLQVSAMQHQTMLELTESGVEAAAASAVSVARNLVIFEVQQPFLFLLWDQQHRFPVFMG
RVYDPLV
Download sequence
Identical sequences F1PYX9
ENSCAFP00000011583 ENSCAFP00000011583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]