SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011756 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011756
Domain Number 1 Region: 2121-2340
Classification Level Classification E-value
Superfamily BEACH domain 1.96e-91
Family BEACH domain 0.000000000794
Further Details:      
 
Domain Number 2 Region: 117-302
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.72e-31
Family Clostridium neurotoxins, the second last domain 0.013
Further Details:      
 
Domain Number 3 Region: 2010-2115
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-29
Family PreBEACH PH-like domain 0.00000262
Further Details:      
 
Domain Number 4 Region: 397-501,580-881
Classification Level Classification E-value
Superfamily ARM repeat 1.36e-19
Family Mo25 protein 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011756   Gene: ENSCAFG00000007907   Transcript: ENSCAFT00000012691
Sequence length 2341
Comment pep:known_by_projection chromosome:CanFam3.1:15:48407933:48916019:-1 gene:ENSCAFG00000007907 transcript:ENSCAFT00000012691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FNLLVGGQFDLEMNFIIQEGESIICMVDLLEKCDITCQAEVWSMFTAILKKSIRNLQVCT
EVGLVEKVLGKIEKVDSMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGQWPPHAGK
LLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMDPVNNINVDK
DKPYLYCFRTSKGLGYSAHFVGGCLIITSIKSKGKGFQHCVKFDFKPQKWYMVTIVHIYN
RWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQMTAVYLFSE
ALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSAIAFTYNPRATDAQ
LCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPLFAQLDYRQYL
SDEVDLTICSTLLAFIMELLKNSIAMQEQMLACKGFLVIGYSLEKSSKSHVSRAVLELCV
AFSKYLSNLQNGMPLLKQLCDHILLNPAIWIHTPAKVQLTLYTYLSTEFIGTVNIYNAIR
RVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLDGPRPNQKEILSLRAFLLMFIKQLVMKD
SGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMSEHPNSMIPAFDQRNGLRVIYKLMA
STSEGIRVQALKAMGYFLKHLAPKRKAEIMLGHGLFSLLAERLMLQTNLITMTTYNVLFE
ILIEHICTQVIHKQHPDPDSSVKIQNPQILKVIATLLRNSPQCSESMEVRRAFLSDMIKL
FNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDEQKITEMVYAIFRILLYHAVKYEWGGW
RVWVDTLSITHSKVTFEMHKENLASMFREHQGKVDEQIGQCSNSLEADSAISRDVNVSVA
SQQTSMKACPVSPHNTRNSDEKSTIEKTVSVDSVSSVGLPTPNASNEERQTGQESQELLD
EVHLEETLINETINTGDLEVSSDTIDAETVSSNSFKMSCKNIMTISEVTASVSSPSEEDT
SEVPEFLDKSIVEEDDDDYVELKVESSPTEEASLPTELQEDSLSPAASEASERLDMLSND
NKLVFQEQESVSKKQSDSETQDSKDSGILTMTASGSSATSPDIIVSQTPVQSDVGEMLQE
GKKTTSFARETKVVGDSPVFEAPTTSEQRIAKLDVSSVATDTERLELKANTNMETSQPHQ
PVLEVSRQQEEPGQGIVPDGVNGQRRDSRSAMFRIPEFKWSQMHQRLLNDLLFAIETDIQ
MWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELEN
IEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKNMSSGGILRQCLRLVCAVA
VRNCLECQQHSQLKARGDTVRGQKTMHSLIPMGKSAAKSPVDIVTGGISPVRDFEKLLQD
MDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEPQNERRNQSFKETGSE
SGNLSLPENTPSAFSPLTPASVEESESTSSTRRRDSGLGEETAVGLGNSVDVVPPVTPPS
VSAGPDAISEALCTLSLEVNKSQETKNDGGNELDNKAAPSVPVSKNVNVKDILRSLVNIP
GDGVTVDPALLPPACLGALGDLSVEQPVQFRSFDRSVIISTKKSAVLPSTLTTSLPTNAV
SVVSSVDSTQTSDGGGESPGGRSSNAKLPSVPTVGSVTSDQVSNMSITERLEHALEKAAP
LLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKN
AGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKR
EDEKMCDHLIRAAKYRDHVTATQLIQKIINILTDKHGAWGNSAVSRPREFWRLDYWEDDL
RRRRRFVRNPLGSTHPEATLKTAVEHVSCIFSMTRGFSAADEDILAKGKQSIKSQALGNQ
NSENEILLEGDDDTLSSVDEKDLENLAGPVSLSTPAQLVAPSIVVKGTLSVTSSELYFEV
DEEDSNFKKIDPKILAYTEGLHGKWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFP
DPATVKKVVNYLPRVGIGTSFGLPQTRRISLASPRQLFKASNMTQRWQHREISNFEYLMF
LNTIAGRSYNDLNQYPVFPWVITNYESEELDLTLPSNFRDLSKPIGALNPKRAAFFAERY
ESWEDDQVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSISRAWR
NCQRDTSDIKELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVRINR
L
Download sequence
Identical sequences F1Q2K8
ENSCAFP00000011756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]