SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011780 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011780
Domain Number 1 Region: 6-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.54e-73
Family BAR domain 0.000000000591
Further Details:      
 
Domain Number 2 Region: 479-633
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-27
Family Phosphotyrosine-binding domain (PTB) 0.0075
Further Details:      
 
Domain Number 3 Region: 278-373
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-22
Family Pleckstrin-homology domain (PH domain) 0.00000209
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000011780
Domain Number - Region: 620-666
Classification Level Classification E-value
Superfamily Gam-like 0.0915
Family Gam-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011780   Gene: ENSCAFG00000007952   Transcript: ENSCAFT00000012718
Sequence length 708
Comment pep:known_by_projection chromosome:CanFam3.1:20:33133549:33166710:-1 gene:ENSCAFG00000007952 transcript:ENSCAFT00000012718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMRRIYDAQNELSAATHL
TSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKE
RDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMH
YFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLTNIGTSVQNVRREM
DSDVETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDRQ
FYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESK
KDHEEWICTINNISKQIYLSENPEEIAARVNQSALEAVTPSPSFQQRHESLRPAAQSRPP
TARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNP
FGESGGGTKSETEDSILHQLFIVRFLGSMEVKSDDSPDVVYETMRQILAARAIHNIFRMT
ESHLLVTCDCLKLIDPQTQLTRLTFPLPCVVLYATHQENKRLFGFVLRTSGGRSESNLSS
VCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEMERVKEKQQKELSKQKQIEK
DLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEEGKKRESEA
Download sequence
Identical sequences E2R6J0
ENSCAFP00000011780 9615.ENSCAFP00000011780 XP_849075.1.84170 ENSCAFP00000011780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]