SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011841 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011841
Domain Number 1 Region: 1403-1572,1631-1692,1760-1859
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.26e-115
Family Mammalian PLC 0.00000572
Further Details:      
 
Domain Number 2 Region: 2145-2255
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.92e-35
Family Ras-binding domain, RBD 0.0000017
Further Details:      
 
Domain Number 3 Region: 407-468,518-736,764-860
Classification Level Classification E-value
Superfamily Ras GEF 3.53e-33
Family Ras GEF 0.0081
Further Details:      
 
Domain Number 4 Region: 2019-2125
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.79e-32
Family Ras-binding domain, RBD 0.00000181
Further Details:      
 
Domain Number 5 Region: 1885-1996
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.32e-22
Family PLC-like (P variant) 0.0031
Further Details:      
 
Domain Number 6 Region: 1219-1250,1333-1391
Classification Level Classification E-value
Superfamily EF-hand 0.00000000015
Family EF-hand modules in multidomain proteins 0.032
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000011841
Domain Number - Region: 866-907,941-1017
Classification Level Classification E-value
Superfamily PH domain-like 0.00959
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011841   Gene: ENSCAFG00000007985   Transcript: ENSCAFT00000012791
Sequence length 2312
Comment pep:known_by_projection chromosome:CanFam3.1:28:8210058:8481765:1 gene:ENSCAFG00000007985 transcript:ENSCAFT00000012791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSEGMAASVLTPVTQRKVTFAPSAVDESSEKVSDISVPKAHSVKQSEQTSTIPWMNKLK
EESSGSNLPKILSIAREKIASDENSNEECWTESTPVSVKNLNINHNNILTNRQCVLPQSQ
SYDTCNSVMEEDPCLETGISSSLERKVFPGIQLEVNRPPMDFRPPGLMDFSTLGSQSAIV
DTGQAHPDSNKAAFQIFNYKVDRRMSDTFCTLSGDLILDDCGNCVPLSSGFGGEQKKNYV
AYTCKLMELAENCDNENGQLQCDDYDALDDKYLCFEDSCQRDSVVCSSDSFRREDLTNSP
PAKTFLSHFEDFPDNGEDVEDFLKNKKERSTLLVRRFCKNDREVKKSVYTGTRAIMRTLP
SGHIGLEAYSYIDQKRSGPLLPRGRVLEQLPVVAIRQDGSQCLSEAQWYRIYNAVRREEE
IENTIGSLLHYFTKLPASKTAHERISVGPCLKQCVRDTICEYRATLQRTSISQYITGSLL
EATTSLGARSGLLSTFGGSTGRMMLKERQPGTSMANSSALPSSSAGISKELIDLQPLIQF
PEEVASILMEQEQNIYRRVLPVDYLYFLTRDLGTPECQTPLPCLKASISASILSSQNGEH
NALEDLVMRFNEKVAAWLSWLTPTLAKMEKKREVFSYLVHVAKCCWNMGNYNAVMEFLAG
LRSRKVLKMWQFMDQSDLETMRSLKDAMAQHESSCEYRKVITRALHIPGCKVVPFCGVFL
KELCEVLDGASGLMKLCPRYNSQEETLEFVADYSGQDNFLQRVGHNGLKNSEKESTVNSI
FQIIRSCSRSLEAEEEDSPSEGNSSRKNSLRDKARWQFIIGDLLDSENDIFEQSKEWDSP
SSEEPQKAFDHGTELIPWYVLSIRADVHQFLLQGATVLRYDQDTHLSARCFLQLQPDNST
LTWIKPTAASPASARAKLGVLSNTSEPGKFPSPGSAGLSGLAEGVLDLFSAKAVYMGHPS
IDIHTVCVQNKLGSMFLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVR
KMRKFPDQRQQWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGTSAKSAEK
PSVQRNNTLGISTTKKKKKILIRGESGEAADDEMATRKAKMHRECRSRSGSDPQDMNEQE
ESEANAIMSPPNTLPSRRAHSLTTAGSPNLSAGTSSPIRPVSSPVLSSSNKSPSSAWSSS
SWHGRIKGGMKGFQSFMVSDSNMSFVEFVELFKSFSVRSRKDLKDLFDIYAVPCNRAGSE
SAPLYTNLTIDENTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTN
GTGIESTSLGIFGVGILQLNDFLVNCQGEHCTYDEILSIIQKFEPSISMCHQGLLSFEGF
ARFLMDKDNFASKNDESQENIKDLQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLL
QGCRSVELDCWDGDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCS
LPQQRKMAEIFKTVFGEKLVAKFLFESDFSDDPMLPSPDQLRRKVLLKNKKLKAHQTPVD
ILKQKAHQLASMQAQAYNGGNVNPPPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKS
CNDKLQFEYNEEIPKRIKKADNSAFNKGKVYDMELGEEFYLPQNKKESRQIAPELSDLVI
YCQAVKFPGTGLSTLNASGSNRGKERKSRKSIFGNNPGRMSPGETASFNKASGKSSCEGM
RQAWEESSSPLNPTTSLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLIQHTACQLLRTY
PAATRIDSSNPNPLLFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDK
NCPMYQKFSPLERDLDNMEPAVYSLTIVSGQNVCPSSSTGSPCIEVDVLGMPLDSCHFRT
KPIHRNTLNPMWNEQFLFRVHFEDLIFLRFAVVENNSSAITAQRIIPLKALKRGYRHLQL
RNLHNEVLEISSLFINSRRMEENSSSSATPASLMFNTEERKCLQTHRVTVHGVPGPEPFT
VFSISGGTKAKQLLQQILTTEQDTKPIVTDYFLMEEKYFISKEKNECRKQPFQRVIGPEE
EIMQILSSWFPEEGYVGRIVLKTQQENLEERSIVQDEKEVILSSEEESFFVQVHDVSPEQ
PRTVIKAPRVSTAQDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDATKKSSTPKSSQ
RVLLDQECVFQAQSKWKGAGKFILRLKEQVQASREDKRKGISFASEFKKFTKSTKQPRGL
TSSQVLASESVQNKEEKPTGSLSSSDTTDSRQ
Download sequence
Identical sequences F1Q101
ENSCAFP00000040707 ENSCAFP00000011841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]