SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011905 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011905
Domain Number 1 Region: 228-437
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-54
Family DBL homology domain (DH-domain) 0.0000641
Further Details:      
 
Domain Number 2 Region: 448-571
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-19
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011905   Gene: ENSCAFG00000008061   Transcript: ENSCAFT00000012861
Sequence length 650
Comment pep:known_by_projection chromosome:CanFam3.1:20:33318047:33625791:1 gene:ENSCAFG00000008061 transcript:ENSCAFT00000012861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRYRGARAGSSPASSQGPRRGAEGSALQQWPPPAHVAAGLPAPAPAPGRPGPAPPGEPPP
QPPRPPQPSALQPRGPSRAAPRKKAWANHAVSLDSSTVMNQCVFRGMEENKERPRRQRQT
NFPMFPSPKAWNFRGRKRKQSTQDEDAVSLCSLDISEPSNKRVKPLSRVTSLANLIPPVK
ATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQML
PSKEIKRQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPL
HEELLSQLRDARKPDGSTEHVGPILVGWLPCLSSYDSYCSNQVAAKALLDHKKQDHRVQD
FLQRCLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEAINIIQG
IVAEINTKTGESECRYYKERLLYLEEGQKDSLIDNSRVLCCHGELKNNRGVKLHVFLFQE
VLVITRAVTHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFFRV
SFKNGSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGDLDSEGPFLNPATGSRE
PQGETKLEQMDQSDSESDCSMDTSEVSLDYERMEQTDSSCGNSRHVESNV
Download sequence
Identical sequences F1Q023
ENSCAFP00000011905 ENSCAFP00000011905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]