SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011909 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011909
Domain Number 1 Region: 119-503
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.82e-135
Family Myotubularin-like phosphatases 0.000000049
Further Details:      
 
Domain Number 2 Region: 5-114
Classification Level Classification E-value
Superfamily PH domain-like 1.06e-18
Family GRAM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011909   Gene: ENSCAFG00000008058   Transcript: ENSCAFT00000012867
Sequence length 549
Comment pep:known_by_projection chromosome:CanFam3.1:25:26571244:26624956:-1 gene:ENSCAFG00000008058 transcript:ENSCAFT00000012867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDK
RFVGPLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVI
EDGWHSFLPEQEFELYSSATSEWRLSYVNKEFAVCPSYPPIVIVPKSIDDEALRKVATFR
HGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRSLN
VAQQARAKGGGFEQEAHYPQWRRIHKSIERYHILQESLIKLVEACNDQTHNMDRWLGKLE
ASNWLTHIKEILTTACLAAQCIDREGASILIHGTEGTDSTLQVTSLAQIILEPRSRTIRG
FEALIEREWLQAGHPFQQRCAQSAYCNSKQKWESPVFLLFLDCVWQILRQFPCSFEFNEN
FLIMLFEHAYASQFGTFLGNNESERCKLKLQQKTMSLWSWVNRPSELSKFTNPLFEANNL
VIWPSVAPQSLQLWEGIFLRWNRSSKYLDEAYEEMVNIIEYNKELQAKVNVLRRQLAELE
TEDGMQESP
Download sequence
Identical sequences E2QWX7
XP_848653.1.84170 ENSCAFP00000011909 9615.ENSCAFP00000011909 ENSCAFP00000011909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]