SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000012181 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000012181
Domain Number 1 Region: 79-160
Classification Level Classification E-value
Superfamily F-box domain 8.76e-20
Family F-box domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000012181   Gene: ENSCAFG00000008297   Transcript: ENSCAFT00000013163
Sequence length 307
Comment pep:novel chromosome:CanFam3.1:25:29084344:29119751:1 gene:ENSCAFG00000008297 transcript:ENSCAFT00000013163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAFAPPKCIDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTG
LLERCSLSQQKFCCQKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVSWHWK
NLTELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHVTKPKTPPKDGFSIAN
VQPVTSRSPGEKQSPASAFRSSSSLRKKTHAAEKELPPWRSSDKHPTDIIRFNYLDNCDP
IEQIWQGRRKRHEMNPDFSRQSRDKKNKLQDRSRLRKAQSLVSITYKSFCTIMFMISNPI
CEMKFVC
Download sequence
Identical sequences E2R9L2
ENSCAFP00000012181 ENSCAFP00000012181 9615.ENSCAFP00000012181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]