SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000012312 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000012312
Domain Number 1 Region: 165-287
Classification Level Classification E-value
Superfamily Cyclin-like 2.64e-39
Family Cyclin 0.000000588
Further Details:      
 
Domain Number 2 Region: 11-164
Classification Level Classification E-value
Superfamily Cyclin-like 4.12e-30
Family Cyclin 0.000000878
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000012312   Gene: ENSCAFG00000008374   Transcript: ENSCAFT00000013308
Sequence length 326
Comment pep:known_by_projection chromosome:CanFam3.1:3:21046611:21065836:1 gene:ENSCAFG00000008374 transcript:ENSCAFT00000013308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKYIIVLKLFYEPSRYFVTLVDF
YLSLCDLMTEKGMLKPSQPTLVLGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDE
FNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTR
YPMMENPEMLRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLM
LKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAALKQKLERCHSAELALNVITKKRKGY
EDDDYVSKKPKHEEEEWTDDDLVDSL
Download sequence
Identical sequences E2QYZ5
ENSCAFP00000031379 ENSCAFP00000012312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]