SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000012384 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000012384
Domain Number 1 Region: 285-427
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 181-286
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-37
Family Second domain of FERM 0.00000428
Further Details:      
 
Domain Number 3 Region: 101-180
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-27
Family First domain of FERM 0.0000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000012384   Gene: ENSCAFG00000008413   Transcript: ENSCAFT00000013383
Sequence length 871
Comment pep:known_by_projection chromosome:CanFam3.1:24:24925721:25050348:1 gene:ENSCAFG00000008413 transcript:ENSCAFT00000013383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTETGPDSEVKKAQEEAPQQPEAAATAAATTPVTPAGHGGHPEANSNEKHPPQQDTRPA
EQSLDMEEKGYGEADGLSERTTPSRAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHG
RGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYP
PDPAQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHIGNYV
SELRFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGID
IMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNH
RSAKRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFF
ERSSSKRYTMSRSLDGAEFSRPASVSENHDTGPDGDKAEEDGESGGRRSEAEEGEVRTPT
KIKELKFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERERRLPSSPASPSPKG
TPEKANERAGLREGSEEKVKPPRPRAPESDTGDEDQDQERDAVFLKDNHLAIERKCSSIT
VSSTSSLEAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSETEGLVFSRDLSKGGPSQE
DESGGIEDSPDRGACATPDMPQFEPVKTETMTVSSLAIRKKIEPEAVLQTRITTMDTTQV
DGTAPGGKESITTAPSITTETISTTMENSLKSGKGAAAMIPGPQTVATEIRSLSPIIGKD
VLTSTYGATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQALALAIKEAK
LQHPDMLVTKAVVYRETDPSPEERDRKPQES
Download sequence
Identical sequences E2QXY5
XP_013962505.1.84170 ENSCAFP00000012384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]