SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000012414 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000012414
Domain Number 1 Region: 5-143
Classification Level Classification E-value
Superfamily Cyclin-like 7.23e-27
Family Cyclin 0.0024
Further Details:      
 
Domain Number 2 Region: 146-241
Classification Level Classification E-value
Superfamily Cyclin-like 0.000000000068
Family Cyclin 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000012414   Gene: ENSCAFG00000008454   Transcript: ENSCAFT00000013415
Sequence length 372
Comment pep:known_by_projection chromosome:CanFam3.1:28:9491765:9508907:1 gene:ENSCAFG00000008454 transcript:ENSCAFT00000013415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEGQWWRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIVSNRFTLCPSA
RHLAVYLLDLFMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL
VLTKQNLLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLYM
AKYADYFLEVSLQVAAACVASSRIILRLSPTWPTRLHRLTAYSWDFLVQCIERLLIAHDN
DVKEANKQRGQAGSQPAQLSVLQSASQPSRPVHFQQPHYLHQTHHTSLQYRHPVAEQPSC
QQIGSTTHTSSYTLQTCPAGFQTSVQGLGHVQTGVGMSLAIPVEVKPCLNVSYNRSYQIN
EHYPCITPCFER
Download sequence
Identical sequences E2R996
ENSCAFP00000040080 XP_005637626.1.84170 ENSCAFP00000012414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]