SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000012548 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000012548
Domain Number 1 Region: 313-439
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000352
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000012548
Domain Number - Region: 39-91
Classification Level Classification E-value
Superfamily HR1 repeat 0.00243
Family HR1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000012548   Gene: ENSCAFG00000008519   Transcript: ENSCAFT00000013561
Sequence length 564
Comment pep:known_by_projection chromosome:CanFam3.1:17:48685089:48699966:1 gene:ENSCAFG00000008519 transcript:ENSCAFT00000013561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSRNHRSRVTVARGSALEMEFKRGRFRLSLFSDPPEDTELQRKLDHEIRMREGACKLLA
ACSQREQALEATKSLLVCNSRILSYMGELQRRKEAQVLEKTGRRPSDSGPPAERSPCRGR
VCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLGEHIQDTEMILVDRTLTDISFQNNV
IFTEAGPDFELRLELYGACMEEEGALAGAPKRLATKLSSSLGRSSGRRVRASLESAGGSG
SSPILLPTPAVGGPRYHLLAHTTLTLAAVQDGFRTHDLTLASHEENPAWLPLYGSVCCRL
VAQPFCMTQPTANGTLRVQQAGELQDWARVHGVLKGTNLFCYRQPEDADTGEEPLFTIAI
NKETRVRAGELEQAAGRPFTLSISNRYGEDEVTHTLQTESRGALHSWMEALWQLFFDMSQ
WKQCCDEIMKIETPVPRKPPQVLAKQGSLYHEMAIEPLDDIAAVTDILAQREGTRLETPP
PWLAMFTEQPALPSPCSPASVAPAPARTYPMPWGRPRTFSLDAVPPDHSPRASHAVAPLP
QQRSPRSRGLFSKGPPRTWLQSPV
Download sequence
Identical sequences E2R3E9
ENSCAFP00000012548 9615.ENSCAFP00000012548 XP_532998.2.84170 ENSCAFP00000012548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]