SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000012677 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000012677
Domain Number 1 Region: 163-381
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.02e-56
Family DBL homology domain (DH-domain) 0.0000525
Further Details:      
 
Domain Number 2 Region: 371-521
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-20
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 3 Region: 529-591
Classification Level Classification E-value
Superfamily SH3-domain 6.96e-17
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000012677   Gene: ENSCAFG00000008638   Transcript: ENSCAFT00000013704
Sequence length 611
Comment pep:known_by_projection chromosome:CanFam3.1:23:48290046:48400079:1 gene:ENSCAFG00000008638 transcript:ENSCAFT00000013704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRASKAPLQNGEPHRRLLKVRSMVEGLRAQDARDEAEPEHDAGSPGSLRRGLRSTSYRRA
VVSGLDLDSPTTSKKKNRMSQPVLRAVMEDKERFSSLGRIKKKMLKGQGTFDGEENAVLY
QNYKEKALDIDSDEESEPKEQKSDEKIVIHHKPLRSTWSQLSAVKRNGLSQTVSQEERKR
QEAIFEVISSEHSYLLSLEILIRMFKNSKELGDTMTKTESHHLFSNITDVCEASKKFFTE
LEARHQNNIFIDDISDIVEKHTASTFDPYVKYCTNEVYQQRTLQKLLATNPSFKEVLSRI
ESHEDCRNLPMISFLILPMQRVTRLPLLMDTICQKTPKDSPKYEVCKRALKEVSKLVRLC
NEGARKMERTEMMYTINSQLEFKIKPFPLVSSSRWLVKRGELTAYVEDTVLFSRRTSKQQ
VYFFLFNDVLIITKKKSEESYNVNDYSLRDQLLVESCDSEELNSSPGKNSSTMLYSRQSS
ASHLFTLTVLSNHASEKVEMLLGAETQSERARWITALGRSSGKLPLDRTSLTQVEVVRSF
TAKQPDELSLQVADVVLIYQRVGDGWYEGERLRDGERGWFPMECAKEITCQATIDKNVER
MGRLLGLETNV
Download sequence
Identical sequences F1PGF9
ENSCAFP00000012677 XP_005634713.1.84170 ENSCAFP00000012677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]