SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000012717 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000012717
Domain Number 1 Region: 76-247
Classification Level Classification E-value
Superfamily PH domain-like 5.25e-35
Family Pleckstrin-homology domain (PH domain) 0.0000537
Further Details:      
 
Domain Number 2 Region: 19-52
Classification Level Classification E-value
Superfamily WW domain 0.0000000163
Family WW domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000012717
Domain Number - Region: 673-781
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0837
Family BAR domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000012717   Gene: ENSCAFG00000008664   Transcript: ENSCAFT00000013753
Sequence length 1232
Comment pep:known_by_projection chromosome:CanFam3.1:21:39427772:39645585:-1 gene:ENSCAFG00000008664 transcript:ENSCAFT00000013753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVDWRPWLQVDPALLLPADLPRGWEEGFTEEGASYFIDHNQQTTAFRHPVSGQFSPENS
EFILQEEPHPHMSKQEKNQRPSSMVSETSTAGTTSTVEAKPGPKMIKSSNKVHSFGKRDQ
AIRRNPNVPVVVRGWLHKQDSSGMRLWKRRWFVLADYCLFYYKDSREEAVLGSIPLPSYV
ISPVAPEDRISRKYSFKAVHTGMRALISNSSMGGSQAEQSGMRTYYFSADTQEDMNAWVR
AMNQAAQVLSRSSLKRDVEKVERQAVPQANHAESCRECGRVGSGHTRDCSHRSHEDSFGF
ERREQEEERYRSQREPLEGKRDRSKARSPYSPTEEDALFVDLPGGLRGQQAQPQRAEKNG
VLPTTYGPVEQNGTGGYQRAFPPRNNLEKHSQRKSSLAQVEHWAKTQKGDGRSLPLDQTL
PRQGPSQSLSFPENYQTLPRSTRHPSGGSSPPPRNLPSDYKYAQDRASHLKMSSEERRAH
RDGTVWQLYEWQQRQQFRHGSPTAPICAGSPEFTDQGRSRSMLEVPRSISVPPSPSDIPP
PGPPRVFPPRRPHTPAERVTVKPPDQRRSVDISLGSSPRKARGHATKNSSHVDRRSMPSM
GYMTHTVSAPSLHGKSADDTYLQLKKDLEYLDLKMTGRDLVKDRSLKPVKIAESDIDVKL
SIFCEQDRILQDLEDKIRALKENKDQLESVLEVLHRQMEQYRDQPQHLEKIAHQQRLLQE
DLVHIRAEISRESTEMENAWNEYLKLESDVEQLKQTLQEQHRRAFFFQEKSQIQKDLWRI
EDVIAGLSANKENFRILVESVKNPERKTVPLFPHPPVPSLSTPESKPPPQPSPPTSPVRT
PLEVRLFPQLQTYVPYRPHPPQLRKVTSPLQSPTKTKPKVEDEAPPRPPLPELYSPEDQP
PAVPPLPKEATIIRHTSVRGLKRQSDERKRDREQGQCVNGDSRVELRSYVSEPELATFSG
DMAQPSLGLVGPDSRYQTLPGRGLSGSTSRLQQSSTIAPYVTLRRGLNAESNKRPKSALE
RLYSGDHQRGKMSAEEQLERMKRHQKALVRERKRTLSQGERTGLPSSRYLSQPLPGDLGS
WKREQDFDLQLLERAMQGERKDKEDNGWLKVQAMPVTELDLEPQDYDLDISRELSKPEKV
SIPERYVELDPEEPPSLEELQARYRKAEKIRNILARSSMCNLQPTSGQDRNSVADLDSQL
QEQERIINISYALASEASQRSKQVAAQAVTDP
Download sequence
Identical sequences F1PE20
ENSCAFP00000012717 ENSCAFP00000012717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]