SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000012814 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000012814
Domain Number 1 Region: 393-580
Classification Level Classification E-value
Superfamily Cyclin-like 5.78e-69
Family Retinoblastoma tumor suppressor domains 0.0000182
Further Details:      
 
Domain Number 2 Region: 787-884,923-968
Classification Level Classification E-value
Superfamily Cyclin-like 1.46e-46
Family Retinoblastoma tumor suppressor domains 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000012814
Domain Number - Region: 20-92
Classification Level Classification E-value
Superfamily Cyclin-like 0.085
Family Transcription factor IIB (TFIIB), core domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000012814   Gene: ENSCAFG00000008696   Transcript: ENSCAFT00000013851
Sequence length 1068
Comment pep:known_by_projection chromosome:CanFam3.1:24:25697470:25757229:-1 gene:ENSCAFG00000008696 transcript:ENSCAFT00000013851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEDDPHAEGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVIHWLA
CSLYVACRKSIIPTVGKGIMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRE
RVERLERNFEVSTVIFKKFEPIFLDIFQNPYEEQPKFPRSRKQRRIPCSVKDLFNFCWTL
FVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIICPNRRDLLNPTFKGLPSDFHTADFK
ASEEPPCIIAVLCELHDGLLVEAKGIKEHYFKPYISKLFDRKVLKGECLLDLSSFTDNSK
AVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFTGETPLGKLTAQANVDCSLQQHFE
KKTSFAPSTPLTGRRYLREKEAVITPVASATQSVSRLQSIVAGLKNAPSEQLINIFESCI
RNPMENIMKIVKGIGETFCQHYTQSTDEQPGSHIDFAINRLKLAEILYYKILETVMVQET
RRLHGMDMSVLLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLRPFYFYKVIEVV
IRSEEGLSRDMVKHLNSIEEQILESLAWSHDSALWEALQASANKVPTCEEVIFPNNFETG
NGGNVQGHLPMMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHERYSSPTAGSAKRRL
FGEDPPKEMLVDRIITEGTKLKIAPSSSITAENISISPGQSLLTMATAIVTGTTGHKVTI
PLHGIANDAGEITLIPISMNTAQESKVESPISLTAQSLIGASPKQTHLTKAQEAHPTGIS
KPKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHL
DQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSIPREVVAYNKNING
DFEMTDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVARVKSFALKYDLSNQDHVMEA
PPLSPFPHIKQQPGSPRRISQQHSIYVSPHKNGSGLTPRSALLYKFNGSPSKSLKDINNM
IRQGEQRTKKRAITIDGDAESPAKRLCQENDDVLLKRLQDVVSERANH
Download sequence
Identical sequences F1PBK3
ENSCAFP00000012808 ENSCAFP00000012814 XP_534412.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]