SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000012866 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000012866
Domain Number 1 Region: 311-478,558-728
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.44e-126
Family Mammalian PLC 0.000000678
Further Details:      
 
Domain Number 2 Region: 153-310
Classification Level Classification E-value
Superfamily EF-hand 1.22e-44
Family EF-hand modules in multidomain proteins 0.011
Further Details:      
 
Domain Number 3 Region: 746-862
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.84e-28
Family PLC-like (P variant) 0.00068
Further Details:      
 
Domain Number 4 Region: 27-139
Classification Level Classification E-value
Superfamily PH domain-like 2.1e-25
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000012866   Gene: ENSCAFG00000008746   Transcript: ENSCAFT00000013905
Sequence length 1669
Comment pep:known_by_projection chromosome:CanFam3.1:23:49279309:49482409:-1 gene:ENSCAFG00000008746 transcript:ENSCAFT00000013905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYWDAEGRSRVQYRRHFLVDNSVFHVERCMSVMQSGTQMIKLKRGTKGLVRLFYLDEHR
TRLRWRPSRKSEKAKILIDSIYKVTEGRQSEIFHRQAEGHFDPSCCFTIYHGNHMESLDL
ITSNPEEARTWITGLKYLMAGISDEDSLAKRQRTHDQWVKQTFEEADKNGDGLLNIEEIH
QLMHKLNVNLPRRKVRQMFQEADTDENQGTLTFEEFCVFYKMMSLRRDLYLLLLNYSDKK
DHLTLEELAQFLKVEQKMSNVTTDYCLDIVRKFEVSEENKAKNVLGIEGFTNFMRSPACD
IFNPLHHEVYQDMDQPLCNYYIASSHNTYLTGDQLLSQSKVDMYARVLQEGCRCVEVDCW
DGPDGEPVVHHGYTLTSKILFRDVVETINKHAFVKNEFPVILSIENHCSVQQQRKIAQYL
KGIFGDKLDLSSVDTGETKQLPSPQSLKGKILVKGKKLPYHLGDDAEEGEVSDEDSADEI
EDECKFKLHYNNGTTEHQVESFIRKKLESLLKESQIRDKEDPDSFTVRALLRATHEGLNA
HLKQHPDVKENGKKSHGRSLMTNFGKHKQKTTKSRSKSYSTDDEEDTQQNPGKETGQLYR
LGRRRKTMKLCRELSDLVVYTNSVAAQDIVDDGTTGNVLSFSETRAHQVVQQKSEQFMIY
NQKQLTRIYPSAYRIDSSNFNPLPYWNAGCQLVALNYQSEGRMMQLNRAKFKTNGNCGYV
LKPQQMCKGTFNPYSGDPLPANPKKQLILKVISGQQLPKPPDSMFGDRGEIIDPFVEVEI
IGLPVDCCKDQTRVVDDNGFNPVWEETLTFTVHMPDIALVRFLVWDHDPIGRDFVGQRTV
TFSSLVPGYRHVYLEGLTEASIFVHITINEIYGKSRQLQGLKGLFNKNPRHGSSENNSHY
VRKRSIGDRILRRTASAPAKGRKKSKMGFQEMVEIKDSVSEAARDQDGVLRRTTRSLQER
PVSLPVDKSLLGALSLPLSETAKDTEGKENSLAEDKDGRRKGKASIKDQHFPNFNKKLSS
SSSALLHKDPRPGGSAVSVASASSASVTGEQLGAPGLRGGRTRSPAPGDCQEQECPRKPR
SPRQHLALEPALTAAQGGVSTQAPARAGGLGEDGSPRSGSRFSQSHLEGRDLEGSWVTGR
AAASLSLSDVSLLCAAHPDSHSAAVLQESDISHLLDTVPLATEGDPGSSISALVGQCEDA
GEPGSLAAAPPPHSTCVAAGHPPLPALDPEPAVEPDAAAGKCKPCFARASPARIPAKGPE
ASAHTLHQTTCATAPRPPPEDQLAAGSHRPGASATCPCPPPRSPGAGQVRGAPGSRSPTP
APAPAAPPADRAPRFHPGDRSVVGAGGAAGPADLPAPAAERPGDDAGPLAAPLQPRRSPH
AVDHVPGARGNGRCPDTPHPRVPAAPHSAPQSTSGLTCPGAAAPTRSRCSHPDAHAEQAR
VPAPRHAPPGPALKLPSPCKSKSLGDLTSEDIACNFESKYQCISRSFVATGLRDQKAVAL
AAAALEPMDALTEQLRRLVSLEQDDGGQVLRAERDASPLPRALVRKLSSRSQSRVRNIAS
RAREKQEAGKQRGAKPGPAAGVVLRHRAAPPPAGTRHSTGSYIAGFLRGGAEDRGIPEGA
CAALRPAPGDHAPGGPAPAARFCSHGSVLHTEPGGGGDDKPEIYFLLRL
Download sequence
Identical sequences F1PBG2
XP_013962204.1.84170 ENSCAFP00000012866 ENSCAFP00000012866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]