SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000012868 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000012868
Domain Number 1 Region: 299-466,545-715
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.4e-126
Family Mammalian PLC 0.000000671
Further Details:      
 
Domain Number 2 Region: 141-298
Classification Level Classification E-value
Superfamily EF-hand 7.78e-45
Family EF-hand modules in multidomain proteins 0.011
Further Details:      
 
Domain Number 3 Region: 733-849
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.13e-28
Family PLC-like (P variant) 0.00068
Further Details:      
 
Domain Number 4 Region: 15-127
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-25
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000012868   Gene: ENSCAFG00000008746   Transcript: ENSCAFT00000013907
Sequence length 1206
Comment pep:known_by_projection chromosome:CanFam3.1:23:49283095:49420790:-1 gene:ENSCAFG00000008746 transcript:ENSCAFT00000013907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLEVYKNLSPEKVERCMSVMQSGTQMIKLKRGTKGLVRLFYLDEHRTRLRWRPSRKSE
KAKILIDSIYKVTEGRQSEIFHRQAEGHFDPSCCFTIYHGNHMESLDLITSNPEEARTWI
TGLKYLMAGISDEDSLAKRQRTHDQWVKQTFEEADKNGDGLLNIEEIHQLMHKLNVNLPR
RKVRQMFQEADTDENQGTLTFEEFCVFYKMMSLRRDLYLLLLNYSDKKDHLTLEELAQFL
KVEQKMSNVTTDYCLDIVRKFEVSEENKAKNVLGIEGFTNFMRSPACDIFNPLHHEVYQD
MDQPLCNYYIASSHNTYLTGDQLLSQSKVDMYARVLQEGCRCVEVDCWDGPDGEPVVHHG
YTLTSKILFRDVVETINKHAFVKNEFPVILSIENHCSVQQQRKIAQYLKGIFGDKLDLSS
VDTGETKQLPSPQSLKGKILVKGKKLPYHLGDDAEEGEVSDEDSADEIEDECKFKLHYNN
GTTEHQVESFIRKKLESLLKESQIRDKEDPDSFTVRALLRATHEGLNAHLKQHPDVKENG
KKSHGRSLMTNFGKHKKTTKSRSKSYSTDDEEDTQQNPGKETGQLYRLGRRRKTMKLCRE
LSDLVVYTNSVAAQDIVDDGTTGNVLSFSETRAHQVVQQKSEQFMIYNQKQLTRIYPSAY
RIDSSNFNPLPYWNAGCQLVALNYQSEGRMMQLNRAKFKTNGNCGYVLKPQQMCKGTFNP
YSGDPLPANPKKQLILKVISGQQLPKPPDSMFGDRGEIIDPFVEVEIIGLPVDCCKDQTR
VVDDNGFNPVWEETLTFTVHMPDIALVRFLVWDHDPIGRDFVGQRTVTFSSLVPGYRHVY
LEGLTEASIFVHITINEIYGKWSPLILNPSYTILHFLGATKSRQLQGLKGLFNKNPRHGS
SENNSHYVRKRSIGDRILRRTASAPAKGRKKSKMGFQEMVEIKDSVSEAARDQDGVLRRT
TRSLQERPVSLPVDKSLLGALSLPLSETAKDTEGKENSLAEDKDGRRKGKASIKDQHFPN
FNKKLSSSSSALLHKDPRPGGSAVSVASASSASVTGEQLGAPGLRGGRTRSPAPGDCQEQ
ECPRKPRSPRQHLALEPALTAAQGGVSTQAPARAGGLGEDGSPRSGSRFSQSHLEGRDLE
GSWVTGRAAASLSLSDVSLLCAAHPDSHSAAVLQESDISHLLDTVPLATEGDPGSSISAL
VGQCED
Download sequence
Identical sequences F1PBG1
ENSCAFP00000012868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]