SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000012879 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000012879
Domain Number 1 Region: 625-689,855-1169
Classification Level Classification E-value
Superfamily Ras GEF 2.35e-109
Family Ras GEF 0.000018
Further Details:      
 
Domain Number 2 Region: 224-447
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-43
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 36-132
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000204
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 
Domain Number 4 Region: 435-590
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000019
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000012879   Gene: ENSCAFG00000008744   Transcript: ENSCAFT00000013919
Sequence length 1170
Comment pep:known_by_projection chromosome:CanFam3.1:3:26055170:26286819:-1 gene:ENSCAFG00000008744 transcript:ENSCAFT00000013919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSVRYNEGHALHLAFLARKEGTKREKMSKRAAEASRWHEKWFALYQNVLFYFEGEQSG
RPAGMYLLEGCSCERTPAPPRAGVGPPGARDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRIMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDSAPFTVVLLAPSRQEKAAWTSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLAKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSRIGALDLTTCSASSSPTATHSPAASPP
PHTGAVLESVPVDRAGVEGSPAVDSTDLSPCRSPSTPQHLRYRQPPGQTADNSHCSVSPA
SAFAIATAAAGHGSPPGFNNTERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNEL
KMNVLNLLEEVLRDPDLLPQERKATANILRALSQDDQDDIHLKLEDIIQLTDCPKAECFE
TLSAMELAEQITLLDHIIFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVAS
QIMNYADVSSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKRTWAKVSKQT
KALMDKLQKTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNF
SKMRMISHIIREIRQFQQTCYRIDHQPKVI
Download sequence
Identical sequences E2RTG6
ENSCAFP00000012879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]