SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000012995 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000012995
Domain Number 1 Region: 552-631
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000327
Family F-box domain 0.0045
Further Details:      
 
Domain Number 2 Region: 646-820
Classification Level Classification E-value
Superfamily RNI-like 0.000000216
Family Cyclin A/CDK2-associated p19, Skp2 0.031
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000012995
Domain Number - Region: 7-40
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0378
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000012995   Gene: ENSCAFG00000008846   Transcript: ENSCAFT00000014048
Sequence length 870
Comment pep:known_by_projection chromosome:CanFam3.1:17:49585403:49609166:1 gene:ENSCAFG00000008846 transcript:ENSCAFT00000014048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLDLPYRCPRCGEHKRFRSLSSLRAHLEYSHTYETLYILSKTNSICGGAAAAAAAAAA
SGFPLAPEPAALLAVPGARREVFESTSFQGKEQAAGPAPAAPHLLHHHHHHAPLAHFAGD
LVPASLPCEELAEPGLVPAAAARYALREIEIPLGELFARKSVASSACSTPPPGPGPGPAS
ASPASPSPADVAYEEGLARLKIRALEKLEVDRRLERLSEEVEQKIAGQVGRLQAELERKA
AELETARQESARLGREKEELEERASELSRQVDVSVELLASLKQDLVHKEQELSRKQQEVV
QIDQFLKETAAREASAKLRLQQFIEELLERADRAERQLQVISSSCGSTPSASLGRGGGGG
GAGPGTRGPGRMREHHAGPAMPSTYAVSRHGSSPSTGASSRVPAASQSSGCYDSDSLELP
RPEEGVPEDSGPGGLGTRAQAANSGSERTQAPRSSGLRRQAIQNWQRRPRRHSTEGEEGD
VSDVGSRTTESEAEGPSDAPRSGPAMAGPLSSCRLSARPEGGSGRGRRAERGSPSRSNEV
ISPEILKMRAALFCIFTYLDTRTLLHAAEVCRDWRFVARHPAVWTRVLLENARVCSKFLA
MLAQWCTQAHSLTLQNLKPRQRGKKESKEEYARSTRGCLEAGLESLLKAAGGNLLILRIS
HCPNILTDRSLWLASCYCRALQAVTYRSATDPVGHEVIWALGAGCREIVSLQVAPLHPCQ
QPTRFSNRCLQMIGRCWPHLRALGVGGAGCGVQGLASLARNCMRLQVLELDHVSEITQEV
AAEVCREGLKGLEMLVLTATPVTPKALLHFNSICRNLKSIVVQIGIGDYFKEPSSPEAQK
LFEDMVTKLQALRRRPGFSKILHIKVDGGC
Download sequence
Identical sequences E2RRY1
XP_540229.3.84170 ENSCAFP00000012995 ENSCAFP00000012995 9615.ENSCAFP00000012995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]