SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013008 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013008
Domain Number 1 Region: 1240-1401
Classification Level Classification E-value
Superfamily PH domain-like 6.7e-75
Family Pleckstrin-homology domain (PH domain) 0.0000000425
Further Details:      
 
Domain Number 2 Region: 1036-1243
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.11e-52
Family DBL homology domain (DH-domain) 0.00000000709
Further Details:      
 
Domain Number 3 Region: 459-581
Classification Level Classification E-value
Superfamily PH domain-like 5.77e-19
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 4 Region: 843-916
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000333
Family PDZ domain 0.028
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000013008
Domain Number - Region: 770-809
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0351
Family Ras-binding domain, RBD 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013008   Gene: ENSCAFG00000008853   Transcript: ENSCAFT00000014061
Sequence length 1591
Comment pep:known_by_projection chromosome:CanFam3.1:31:26058784:26259995:-1 gene:ENSCAFG00000008853 transcript:ENSCAFT00000014061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAESQNVEHEFYGEKHASLGRKHTSRSLRLSHKARRTRHASSGKMIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQEGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTA
ASVQSMPDSEESRLYGDDATYLADGGRRQHPYTSNGPTFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSTEEKDCEEARGMEPRVSPRQLSTCQRANSLGDLYAQKN
SGVTANGGPRSKFAGCCRNLVSDIPDLANHKMPPAAAEESLPYSNYNTLPCRKSHCLSEG
ATNPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPP
TGRAFVGSDSGSSSTGDAARQGVYENFRRELELSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESD
GRSGIDHNSIPKHAVWVENSIVQSVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACAAAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRYRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGS
DAVKKSLEGIFDDTVPDGKREKEMVLPSVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTV
VRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQHYVPKPEEDIYELLYKEIEICP
KVTQNIQIEKSDTASDNYGFSLSSVEEDGVRRLYVNSVKETGLASKKGLKAGDEILEINN
RAAGTLNSSVLKDFLSQPSLGLLVRTYPEPEGGLELLDCPPHRADGPVDLSESPLAFLSS
NPGHSLCSEQGSSAETAPEETEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDPSPP
PQDATGPQLATMRQLTDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKAKTDPAFKAFLDAQNPKQQHSATLESYLIKPIQRILKYPLLL
KELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTTVIWPNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEDWDPFRFRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERVFHLCCSSP
ESRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAISASSPEKESQQPPGGGDTDRWVEEQFDLAQYEEQDDIK
ETDILSDEDEFCESVRGTAVDTELQEQLQAVSIGQRERGRRALDSHASRMTQLKKQAALS
GINGGLESPGDEVIWVRREDFAPSRKLNTEI
Download sequence
Identical sequences E2R0M7
ENSCAFP00000013005 ENSCAFP00000013008 9615.ENSCAFP00000013005 XP_005638878.1.84170 XP_005638879.1.84170 XP_005638880.1.84170 XP_013965236.1.84170 XP_013965237.1.84170 XP_544855.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]