SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013033 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013033
Domain Number 1 Region: 21-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.08e-69
Family FCH domain 0.0048
Further Details:      
 
Domain Number 2 Region: 360-422
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-18
Family SH3-domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013033   Gene: ENSCAFG00000008866   Transcript: ENSCAFT00000014088
Sequence length 424
Comment pep:known_by_projection chromosome:CanFam3.1:18:42394453:42398841:1 gene:ENSCAFG00000008866 transcript:ENSCAFT00000014088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEEDAGGEALEGSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADW
ARKWRGTVEKGPQYGTLEKAWHAFFTAAERLSALHLEVREKLQGQDSERVRSWQRGAFHR
PVLGGFRESRAAEDGFRKAQKPWLKRLKEVEASKKSYHAARKEEKTAQTRESHAKADSAV
SQEQLRKLQERVERCAREAEKMKSHYEQTLAELHRYTPRYMEDMEQAFETCQAAERQRLL
FFKEMLLTLHQHLDLSSSERFHELHRDLHQGIEAASDEEDLHWWRSTHGPGMAMNWPQFE
EWSLDTQRTISRKEKGGRSSDEVTLTSIVPTRDGAAPPPQSPGSPGGGQDEEWSDEENPR
KAAMGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQLQSGRIGLYPANYVE
CVGA
Download sequence
Identical sequences F1Q436
ENSCAFP00000013033 ENSCAFP00000013033 XP_005631321.2.84170 XP_013976435.1.84170 XP_013976436.1.84170 XP_013976437.1.84170 XP_013976438.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]