SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013048 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013048
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily Cyclin-like 6.98e-36
Family Cyclin 0.0059
Further Details:      
 
Domain Number 2 Region: 132-229
Classification Level Classification E-value
Superfamily Cyclin-like 5.03e-33
Family Cyclin 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013048   Gene: ENSCAFG00000008884   Transcript: ENSCAFT00000014104
Sequence length 461
Comment pep:known_by_projection chromosome:CanFam3.1:23:50640175:50652303:-1 gene:ENSCAFG00000008884 transcript:ENSCAFT00000014104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSMQDAFDLPSETDLRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEI
VAMACINLASKIEKAPRRIRDVINVFHHLRQLRGKRTPSPLILDQNYINTKNQVIKAERR
VLKELGFCVHVKHPHKIIVMYLQVLECERNQTLVQTAWNYMNDSLRTNVFVRFQPETIAC
ACIYLAARALQIPLPTRPHWFLLFGTTEEEIQEICIETLRLYTRKKPNYELLEKEVEKRK
VALQEAKLKAKGLNPDGTPALSTLGGFSPASKPCKASPREVKAEEKSPVSVNVKTVKKEP
EDRQQASKSPYNGVRKDSKRSRNSRSASRSRSRTRSRSRSHTPRRHYNNRRSRSGTYSSR
SRSRSRSHSESPRRHHNHGSPHLKAKHTRDDLKSSNRHGHKRKKSRSRSQSKSRDHSDAA
KKHRHERGHHRDRRERSRSFERSHKGKHHGGSRSGHGRHRR
Download sequence
Identical sequences F1Q423
9615.ENSCAFP00000013048 ENSCAFP00000013048 ENSCAFP00000013048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]