SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013095 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013095
Domain Number 1 Region: 11-115
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.4e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013095   Gene: ENSCAFG00000008903   Transcript: ENSCAFT00000014154
Sequence length 520
Comment pep:known_by_projection chromosome:CanFam3.1:18:42399831:42409003:1 gene:ENSCAFG00000008903 transcript:ENSCAFT00000014154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEPSKTEIQTLFKRLRGIPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHL
SFIRSTELDSNWNWFQLRCMQVGGNANATAFFRQHGCTASDANTKYNSRAAQMYREKIRQ
LGSAALARHGTDLWIDNVSSAPSHSPEKKDSDFFTEHTQPPAWKVQAPDPAETQQLTPST
EISSLAQPEHSPNMDLLGTSPKASLEPRTSLIGKKKPAAAKKGLGAKKGLGAQKVSSQSF
SEIERQAQVAEKLREQQAADAKKQAEESMVASMRLAYQELQIDRKKEEKKLQNLEGKKRE
QAERLGMGLVSRSSISHSVLSEMQVIEQETPVSAKSSRAQLDLFDDVGTFASGPPKYKDN
PFSLGESFSSRWDTDAAWGVDRMEEKEPEVTISSIRPISERVTNRREVESRNSGLESSEA
RQKFAGAKAISSDMFFGREVDAEHEARSRLQQLSGSSAISSSDLFGDVDGAHGVGSVSLG
NVLPTADIAQFKQGVKSVAGKMAVLANGVMNSLQDRYGSY
Download sequence
Identical sequences E2QYR7
ENSCAFP00000013095 XP_540747.2.84170 ENSCAFP00000013095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]