SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013117 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013117
Domain Number 1 Region: 7-150
Classification Level Classification E-value
Superfamily Cyclin-like 1.97e-47
Family Cyclin 0.000000255
Further Details:      
 
Domain Number 2 Region: 151-254
Classification Level Classification E-value
Superfamily Cyclin-like 1.31e-33
Family Cyclin 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013117   Gene: ENSCAFG00000008923   Transcript: ENSCAFT00000014180
Sequence length 652
Comment pep:known_by_projection chromosome:CanFam3.1:27:5788785:5821974:1 gene:ENSCAFG00000008923 transcript:ENSCAFT00000014180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGERKNNNKRWYFSREQLENSPSRRFGLDPDKELSYRQQAANLLQDMGQRLNVSQLTIN
TAIVYMHRFYMIQSFTQFHRNSVAPAALFLAAKVEEQPKKLEHVIKVAHACLHPQESLPD
TRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATN
SLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHE
FLQILEKTPNRLKRIRNWRACQAAKKTKADDRGADENTSEQTILNMISQSSSDTTIAGLM
SMSTSSTSAVPSLPATEESSSNLSNVEMLQGERWLSSQPPFKLEPAQGHRTSENLALIGV
DHSLQQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAY
AAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKTDKAALKMRIPVASGDKAASSKPEEI
KMPPKVHAAADKHNSLEDSVTKSREHKEKHKTHPSNHHHHHNHHSHKHSHSQLPAGTGNK
RPGDPKHSSQTSTLAHKTYSLSSSFSSSSSTRKRGPPEETGGPMFDHPAKIAKSTKSSSV
NFTFPPLPTMAQLPGHSSDTSGLSFSQPSCKTRVPHMKLDKGPTGANGHNVD
Download sequence
Identical sequences F6V6A9
ENSCAFP00000013117 XP_005636953.1.84170 ENSCAFP00000013117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]