SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013505 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013505
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-37
Family TFIIH domain 0.00000173
Further Details:      
 
Domain Number 2 Region: 104-149
Classification Level Classification E-value
Superfamily BSD domain-like 0.0000000000000785
Family BSD domain 0.0001
Further Details:      
 
Domain Number 3 Region: 185-232
Classification Level Classification E-value
Superfamily BSD domain-like 0.00000902
Family BSD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013505   Gene: ENSCAFG00000009171   Transcript: ENSCAFT00000014599
Sequence length 548
Comment pep:known_by_projection chromosome:CanFam3.1:21:40770966:40807867:1 gene:ENSCAFG00000009171 transcript:ENSCAFT00000014599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGK
AKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQE
DPVLFQLYKDLVVSQVISAEEFWANRLNVNATESSSTSNHKQDVGISAAFLADVRPQTDG
CNGLRYNLTSDIIESIFRTYPAVKMKYAENVPHNMTEKEFWTRFFQSHYFHRDRLNTGSK
DLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKSLDEGYGISSVPSTSNSKSIKENSN
AAIIKRFNHHSAMVLAAGLRKQEAQNEQNGEPSSIDGNSGDADCFQPAVKRAKLQESIEY
EDLGKNNSIKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQ
VLSSSAASSTITTLSPGGALMQGGTQQAINQMVPNDIQSELKHLYVAVGELLRHFWSCFP
VNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHKWQ
SRRLMKKT
Download sequence
Identical sequences E2RCX0
XP_013978133.1.84170 ENSCAFP00000013505 ENSCAFP00000013505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]