SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013586 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013586
Domain Number 1 Region: 2744-3005
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.92e-69
Family Protein kinases, catalytic subunit 0.00000303
Further Details:      
 
Domain Number 2 Region: 1898-2094
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-54
Family DBL homology domain (DH-domain) 0.0000124
Further Details:      
 
Domain Number 3 Region: 1233-1411
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-50
Family DBL homology domain (DH-domain) 0.00000000844
Further Details:      
 
Domain Number 4 Region: 2096-2218
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-33
Family Pleckstrin-homology domain (PH domain) 0.00059
Further Details:      
 
Domain Number 5 Region: 1415-1533
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-32
Family Pleckstrin-homology domain (PH domain) 0.000000529
Further Details:      
 
Domain Number 6 Region: 2637-2733
Classification Level Classification E-value
Superfamily Immunoglobulin 4.78e-22
Family I set domains 0.0079
Further Details:      
 
Domain Number 7 Region: 250-386
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-21
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 8 Region: 1047-1184
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-20
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 797-950
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-19
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 471-612
Classification Level Classification E-value
Superfamily Spectrin repeat 2.44e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 11 Region: 2502-2566
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000938
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 12 Region: 1584-1675
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000462
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 13 Region: 6-160
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000017
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 14 Region: 617-724
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000972
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 15 Region: 164-280
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000222
Family Spectrin repeat 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000013586
Domain Number - Region: 391-503
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0767
Family Spectrin repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013586   Gene: ENSCAFG00000009159   Transcript: ENSCAFT00000014689
Sequence length 3053
Comment pep:known_by_projection chromosome:CanFam3.1:34:269491:505656:-1 gene:ENSCAFG00000009159 transcript:ENSCAFT00000014689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLACIPSEEV
CKRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEF
ETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNATHMLSRLEELQD
ILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQKLLQRIQSSDSFPKKNSGS
GNADLQSLLPKVSAMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWITHN
KGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQI
KQIANQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLPSELQD
LEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLD
VIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKS
LHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDF
VRRVEQRKILLDMSVSFHSHVKELWTWLEELQKELLDDVYAESVEAVQDLIKRFGQQQQT
TLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSISHIETVLQQLDEAQAQMEELFQERK
IKLELFLQLRIFERDAIDIISDLESWNDELSQQMNDFDTEDLTIAEQRLQHHADKALTMN
NLTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQELDLAAEQH
RKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEK
THQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKT
SEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARR
NADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQ
YVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLL
IQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSNKSSKSL
QLDIIPASVPGSEVKLRDAAHELNEEKRKSARRKEFIMAELIQTEKAYVRDLRECMDTYL
WEMTSGVEEIPAGIVNRELVIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTWADK
FQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKEL
LTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENIESQGELILQESFQVWDPKT
LIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWV
GRTPTSDNKIVLKASSIENKQDWIKHIREVIQERTIHLKGALKEPIHIPKTAPATRQKGR
RDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSTELTIRR
GQTVEVLERPHDKPDWCLVRTTDRSPAAEGLVPCGSLCIAHSRSSMEMEGIFNHKDSLSV
SSNDASPPASVASLQPHLMGAQSSPGPKRPGNTLRKWLTSPVRRLSSGKADGHVKKLAHK
HKKSREVRKSTDAGSQKDSDDSAATPQDETVEERGRNEGLSSGTLSKSSSSGMQSCGEEE
GEEGADAVPLPPPMAIQQHSLLQPDSQDDKASSRLLVRPTSSETPSAAELVSAIEELVKS
KMALEDRPSSLLVDQGDSSSPSFNPSDNSLLSSSSPIDEMEERKSSSLKRRHYVLQELVE
TERDYVRDLGYVVEGYMALMKEDGVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEKCLE
DPEKLGSLFVKHERRLHMYIVYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTDLLIK
PVQRIMKYQLLLKDFLKYSKKASLDTSELERAVEVMCIVPKRCNDMMNVGRLQGFDGKIV
AQGKLLLQDTFLVTDQDSGLLPRCKERRVFLFEQIVIFSEPLDKKKGFSMPGFLFKNSIK
VSCLCLEENVENDPCKFALTSRTGGVVETFILHSSSPSVRQTWIHEINQILENQRNFLNA
LTSPIEYQRNHSGGGGGGSGGGGGSGGSGGGAGSGAPGGGGSNPSGGPGSCSGLPSSSRS
RPSRIPQPVRHHSPVLVSSAASGQAEADKMSGTSTPGPALAPPGSSPAPEPGPSQPGRRA
PEPGGPEREAELIPRMKVIESPRRCSGGAAGAGRDADTKEARAPPEDSRSRSSPGSLPLA
KPRPGATSPLNSPVAAALPPPIGKEPCPPSSPLQKGGSFWSSIPASPASRPGSFTFPGDS
DSLQRQAQRHAAPSKDTDRMSTCSSASEQSVQSTQSNGSESSSSSNISTMLVTHDYTAVK
EDEINVYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSAVIMENPDGTL
KKSTSWHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLSSKVSVKLLNPNYIYDVPPE
FVIPLSEVTCETGETVVFRCRVCGRPKASITWKGPEHNTLNNDGHYSISYSDLGEAALKI
VGVTTEDDGIYTCIAVNDMGSASSSASLRVLGPGSDGIMVTWKDNFDSFYSEVAELGRGR
FSVVKKCDQKGTKRAVATKFVNKKLMKRDQVTHELGILQNLQHPLLIGLLDTFETPTSYV
LVLEMADQGRLLDCVVRWGDLTEGKIRAYLGEVLEAVQYLHNCRIAHLDLKPENILVDQS
LAKPTIKLADFGDAVQLNTTYYIHQLLGNPEFAAPEIILGNPISLTSDTWSVGVLAYVLL
SGVSPFLDDSVEETCLNICRLDFSFPEDCFKGVSQKAKEFVCFLLQEDPARRPSAALALQ
EQWLQAGHGGGKGAGVLDTSRLTSFIERRKHQNDVRPIRSVKNFLQSRLLPRV
Download sequence
Identical sequences F1PVV4
ENSCAFP00000013586 ENSCAFP00000013586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]