SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013671 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013671
Domain Number 1 Region: 1-378
Classification Level Classification E-value
Superfamily Serpins 1.96e-123
Family Serpins 0.0000000000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013671   Gene: ENSCAFG00000009276   Transcript: ENSCAFT00000014778
Sequence length 378
Comment pep:known_by_projection chromosome:CanFam3.1:35:3147428:3153915:-1 gene:ENSCAFG00000009276 transcript:ENSCAFT00000014778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLSGANRRFPWALFGVLGKAILVGNFFFSPLTFSWGGALFFRGIGGTPPVLFSRALHF
DAVEEIHSRFQSLNADINKRGASYILKLANRLYGEKTYNFLPEFLASTQKMYGAELASVD
FQQASEEARKAINKWVKGQTEGKIPELLAAGTVDSMTKLVLVNAIYFKGSWEDEFSKKDT
ADAPFRLNKKDKKTVKMMYKKKKFPFGYIEDLKCRVLELPYRGRELSMLILLPDDIEDES
TGLKKIEEHLTLEKLHEWTKAENLDRVEVNVYLPKFKLEESYELNSHLAHLGVQDLFTGR
ADLSGMSGVRDLFISKIVHKSFVEVNEEGTEAAAATAGIATFAMMMHEENFVADHPFIFF
IRHNPSSNILFLGRLCSP
Download sequence
Identical sequences E2RKJ6
ENSCAFP00000013671 ENSCAFP00000013671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]