SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013751 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013751
Domain Number 1 Region: 128-329
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.2e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 18-124
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-32
Family Pleckstrin-homology domain (PH domain) 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000013751
Domain Number - Region: 640-736
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000889
Family FCH domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013751   Gene: ENSCAFG00000009320   Transcript: ENSCAFT00000014859
Sequence length 749
Comment pep:known_by_projection chromosome:CanFam3.1:32:9072318:9577333:1 gene:ENSCAFG00000009320 transcript:ENSCAFT00000014859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEENNDSTDYPQQGQGRNNAMKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPL
GTIFLPGNKVLEHPCNEESPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSI
RRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQA
NLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSK
EEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPK
VEDPLTIMEGTVVVQQLMSVMISKHDRLFPKDTEPQGKPQDGVSNNNNEIQKKATMGQLQ
NKENNNTKDSPGRQCSWEKSESPQRSSVDNGSPTALPGSKTNSPRNSVHKLDVSRSPPLM
VKKNPAFNKGSGIVTNGSFSSGNAEGLEKTQTTPNGSLQARRTSSLKGSGTKMGTHSVQN
GTVRMGILNPDTLGNPLNGRSMSWLPNGYVTLRDNKQKEQAGESGQHNRLSTYDNVHQQF
SMMNLDDKQSVDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFYGGNFEDPVLDGPPQD
DLSHPGDYENKSDRRSVGGRSSRATSSSDNSETFVGNNTSNHSALHSLVSSLKQEMTKQK
IEYESRIKSLEQRNLTLETEMMTLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQ
KEMEQFFSTFGELTVEPRRTERGNTIWIQ
Download sequence
Identical sequences E2RFM4
XP_003434065.1.84170 XP_005639200.1.84170 ENSCAFP00000013751 ENSCAFP00000013751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]