SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013853 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013853
Domain Number 1 Region: 163-270
Classification Level Classification E-value
Superfamily Cyclin-like 9.19e-20
Family Cyclin 0.019
Further Details:      
 
Domain Number 2 Region: 3-160
Classification Level Classification E-value
Superfamily Cyclin-like 2.95e-19
Family Cyclin 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013853   Gene: ENSCAFG00000009406   Transcript: ENSCAFT00000014967
Sequence length 408
Comment pep:known chromosome:CanFam3.1:32:9993644:9995053:1 gene:ENSCAFG00000009406 transcript:ENSCAFT00000014967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMDEPWWEGRVASDVHCTLREKELKLPAFRAHSLLLKSRRFFVDILTLLSSHCQLCPAAR
HLAVYLLDHFLDRYNITTSKQLYAVAVSCLLLARSIDLWSEREKCLDDIQGKFEDREDHV
PKLEQINSTRILSGQNFTLTKKELLNTELLLLEAFGWNLCLPTPAHFLDYYLLASVSQKD
HHCHSWPTACPRKTKECLKEYAHYFLEVTLRDHIFYKFQPSVVAAACVGASRICLQLSPY
WTRDLQRISNYSLEHLSTCIEILLVAYDNVFKDAVAVKSQSLTMVPSRSPAPTQVLFQPP
TYPTLSQPATTPALAQFQTQTPVQDLCLAYRDSLQAHRSGSLLSGGSGLSLHTLYPTLQP
LDVCPMSLPAPLSVQMAITAEPRHCLATAYGSSYFSGSHAFPTGCFDR
Download sequence
Identical sequences F1PMM4
ENSCAFP00000042757 ENSCAFP00000013853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]