SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013863 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013863
Domain Number 1 Region: 126-374
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.05e-69
Family Nuclear receptor ligand-binding domain 0.00000000136
Further Details:      
 
Domain Number 2 Region: 57-140
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013863   Gene: ENSCAFG00000009411   Transcript: ENSCAFT00000014977
Sequence length 474
Comment pep:known_by_projection chromosome:CanFam3.1:24:31882174:31908566:1 gene:ENSCAFG00000009411 transcript:ENSCAFT00000014977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGANLNAPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSQQITSPVSGINGDIRAKK
IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK
DVLLLGNDYIVPRHCPELAEMSRVSMRILDELVLPFQELQIDDNEYACLKAIIFFDPDAK
GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL
FGMAKIDNLLQEMLLGGSSSDAPHAHHPLHPHLMQEHMGTNVIVANTMPSHLSNGQMCEW
PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAIATIVKPPSAIPQPTITKQEVI
Download sequence
Identical sequences E2R9S0
XP_852731.1.84170 ENSCAFP00000013863 ENSCAFP00000013863 9615.ENSCAFP00000013863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]