SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013981 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013981
Domain Number 1 Region: 1213-1435
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-63
Family DBL homology domain (DH-domain) 0.00000000275
Further Details:      
 
Domain Number 2 Region: 1435-1575
Classification Level Classification E-value
Superfamily PH domain-like 7.96e-33
Family Pleckstrin-homology domain (PH domain) 0.000000217
Further Details:      
 
Domain Number 3 Region: 210-309
Classification Level Classification E-value
Superfamily EF-hand 5.19e-30
Family Eps15 homology domain (EH domain) 0.0013
Further Details:      
 
Domain Number 4 Region: 1589-1709
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.49e-26
Family PLC-like (P variant) 0.01
Further Details:      
 
Domain Number 5 Region: 1135-1218
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-26
Family SH3-domain 0.0000509
Further Details:      
 
Domain Number 6 Region: 7-105
Classification Level Classification E-value
Superfamily EF-hand 1.27e-25
Family Eps15 homology domain (EH domain) 0.0014
Further Details:      
 
Domain Number 7 Region: 740-814
Classification Level Classification E-value
Superfamily SH3-domain 7.61e-20
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 8 Region: 908-970
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-19
Family SH3-domain 0.0000918
Further Details:      
 
Domain Number 9 Region: 993-1055
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-18
Family SH3-domain 0.00011
Further Details:      
 
Domain Number 10 Region: 1069-1139
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-17
Family SH3-domain 0.0000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013981   Gene: ENSCAFG00000032220   Transcript: ENSCAFT00000015109
Sequence length 1716
Comment pep:novel chromosome:CanFam3.1:31:29212838:29355107:1 gene:ENSCAFG00000032220 transcript:ENSCAFT00000015109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQ
IWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGIGGI
ASMPPLTAVAPVPMGSIPVVGMSPPLVSSVPTAAVPPLANGAPPVIQPLPAFAHPAATLP
KSSSFSRSGPGSQLNTKLQKAQSFDVASVPPVAEWAVPQSSRLKYRQLFNSHDKTMSGHL
TGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLP
PEYIPPSFRRVRSGSGISVISSTAVDQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFER
GNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELE
RQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEF
ELEALNDKKHQLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQEAQQMLGR
LIPEKQILNDQLKQVQQNSLHRDSLLTLKRALEAKELARQQLRDQLDEVEKETRSKLQEI
DIFNNQLKELREIHSKQQLQKQKSIEAERLKQKEQERKTIELEKQKEEAQRRAQERDKQW
IEHVQQDDEHQRPRKIHDEEKLRREESVKKKDSEEKSKLDTQDKMSRLFHQHQEPAKPAV
QAPWSTTEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVDESQTGEPGWL
GGELKGKTGWFPANYAEKIPENEVPAPVKPGPDLTSAPAPKLAVRETPAPVAVSAPEPST
TPNSWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATGSSPSP
VLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSY
VKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPAISGEEFIAMYTYESSEQGDLTFQQ
GDVILVTKKDGDWWTGAVGDKSGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIACY
TATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKITP
TEPPKPTAFPAVCQVIGVYDYSAQNDDELAFSKGQIINVLNKDDPDWWKGEVNGQVGLFP
SNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQK
PLMESELLTEKEGAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILTAQLPH
MQPYIRFCSCQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRY
PLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGL
SEQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQIIKPLGSSGTDKVF
SPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERTAWVQK
IKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTM
GSQCHITKTIQDTLNPKWNSNCQFFIKDLEQEVLCITVFERDQFSPDDFLGRTEIRVADI
KKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP
Download sequence
Identical sequences L7MTN8
XP_005638918.1.84170 XP_013965222.1.84170 ENSCAFP00000013981 ENSCAFP00000013981 ENSCAFP00000014000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]