SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014017 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014017
Domain Number 1 Region: 1218-1440
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-63
Family DBL homology domain (DH-domain) 0.00000000275
Further Details:      
 
Domain Number 2 Region: 1440-1580
Classification Level Classification E-value
Superfamily PH domain-like 7.96e-33
Family Pleckstrin-homology domain (PH domain) 0.000000217
Further Details:      
 
Domain Number 3 Region: 210-309
Classification Level Classification E-value
Superfamily EF-hand 5.19e-30
Family Eps15 homology domain (EH domain) 0.0013
Further Details:      
 
Domain Number 4 Region: 1594-1714
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.49e-26
Family PLC-like (P variant) 0.01
Further Details:      
 
Domain Number 5 Region: 1140-1223
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-26
Family SH3-domain 0.0000509
Further Details:      
 
Domain Number 6 Region: 7-105
Classification Level Classification E-value
Superfamily EF-hand 1.27e-25
Family Eps15 homology domain (EH domain) 0.0014
Further Details:      
 
Domain Number 7 Region: 913-975
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-19
Family SH3-domain 0.0000918
Further Details:      
 
Domain Number 8 Region: 998-1060
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-18
Family SH3-domain 0.00011
Further Details:      
 
Domain Number 9 Region: 740-819
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-18
Family SH3-domain 0.00018
Further Details:      
 
Domain Number 10 Region: 1074-1144
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-17
Family SH3-domain 0.0000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014017   Gene: ENSCAFG00000032318   Transcript: ENSCAFT00000015145
Sequence length 1721
Comment pep:novel chromosome:CanFam3.1:31:28314021:28456301:1 gene:ENSCAFG00000032318 transcript:ENSCAFT00000015145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQ
IWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGIGGI
ASMPPLTAVAPVPMGSIPVVGMSPPLVSSVPTAAVPPLANGAPPVIQPLPAFAHPAATLP
KSSSFSRSGPGSQLNTKLQKAQSFDVASVPPVAEWAVPQSSRLKYRQLFNSHDKTMSGHL
TGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLP
PEYIPPSFRRVRSGSGISVISSTAVDQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFER
GNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELE
RQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEF
ELEALNDKKHQLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQEAQQMLGR
LIPEKQILNDQLKQVQQNSLHRDSLLTLKRALEAKELARQQLRDQLDEVEKETRSKLQEI
DIFNNQLKELREIHSKQQLQKQKSIEAERLKQKEQERKTIELEKQKEEAQRRAQERDKQW
IEHVQQDDEHQRPRKIHDEEKLRREESVKKKDSEEKSKLDTQDKMSRLFHQHQEPAKPAV
QAPWSTTEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVKGEWVDESQTG
EPGWLGGELKGKTGWFPANYAEKIPENEVPAPVKPGPDLTSAPAPKLAVRETPAPVAVSA
PEPSTTPNSWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATG
SSPSPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGW
FPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPAISGEEFIAMYTYESSEQGD
LTFQQGDVILVTKKDGDWWTGAVGDKSGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQ
VIACYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGT
SKITPTEPPKPTAFPAVCQVIGVYDYSAQNDDELAFSKGQIINVLNKDDPDWWKGEVNGQ
VGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVT
EIFQKPLMESELLTEKEGAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILT
AQLPHMQPYIRFCSCQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQ
RVTRYPLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHV
QCEGLSEQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQIIKPLGSSG
TDKVFSPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERT
AWVQKIKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPY
CEVTMGSQCHITKTIQDTLNPKWNSNCQFFIKDLEQEVLCITVFERDQFSPDDFLGRTEI
RVADIKKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP
Download sequence
Identical sequences F1PHV6
ENSCAFP00000014017 XP_003640127.1.84170 XP_005638937.1.84170 ENSCAFP00000014017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]