SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014197 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014197
Domain Number 1 Region: 425-610
Classification Level Classification E-value
Superfamily Cyclin-like 1.29e-65
Family Retinoblastoma tumor suppressor domains 0.0000433
Further Details:      
 
Domain Number 2 Region: 834-934
Classification Level Classification E-value
Superfamily Cyclin-like 3.97e-37
Family Retinoblastoma tumor suppressor domains 0.00044
Further Details:      
 
Domain Number 3 Region: 990-1039
Classification Level Classification E-value
Superfamily Cyclin-like 0.00000408
Family Retinoblastoma tumor suppressor domains 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000014197
Domain Number - Region: 48-115
Classification Level Classification E-value
Superfamily Cyclin-like 0.000232
Family Transcription factor IIB (TFIIB), core domain 0.02
Further Details:      
 
Domain Number - Region: 9-16
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0471
Family Formin homology 2 domain (FH2 domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014197   Gene: ENSCAFG00000009654   Transcript: ENSCAFT00000015343
Sequence length 1139
Comment pep:known_by_projection chromosome:CanFam3.1:2:62265293:62315371:-1 gene:ENSCAFG00000009654 transcript:ENSCAFT00000015343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSGGDQSPPPPPPPPAAAASDEEEEDDGEAEDAAQPARSPAPQTQQRFDELCSRLNMDE
AARAEAWDSYRNMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTVEGNYVSLTRILRC
SEQSLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEE
QPRQQRGRKQRRQPCTVSEVFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGNA
LQCSNRKELVNPNFKGLSEDFHAKDSKPSSDPPCVIEKLCSLHDGLVLEAKGIKEHFWKP
YIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDERIFLGDDAEE
EIGTLSKCLNSGSGTETAERVQMKNILQQHFDKSKALRISTPLTGVRYMKDNSPCVTPVS
TATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMYEIYSQHCQPDEDF
SNSKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVVT
FSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKP
ESPLWDRIRDNENRVPTCEEVMPPQNLERADDICIAGSPLTPRRVSEVRADTGGLGRSIT
SPATLYDRYSSPTASSTRRRLFVENDSPSDGGTPGRIPPQPLVNAVPVQNVSGETVSVTP
VPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSIQPLS
AQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGHQQKQGPPLTGSSIRPRKTSSLSLFFR
KVYHLAGVRLRDLCAKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIYVMAK
VTKEDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRKRRNSGSSDSRSHQNSPTELNKDRT
SRDSSPVMRSSSTLPVPQPSSAPPTPTRLTGANSDMEEEERGDLIQFYNNIYIKQIKTFA
MKYSQANIMDAPPLSPYPFVRTGSPRRIQLSQNHPVYISPHKNETMLSPREKIFYYFSNS
PSKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQDVANDRGSH
Download sequence
Identical sequences E2RIG3
ENSCAFP00000014197 ENSCAFP00000014197 XP_535303.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]