SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014358 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014358
Domain Number 1 Region: 6-81
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-17
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014358   Gene: ENSCAFG00000009773   Transcript: ENSCAFT00000015519
Sequence length 834
Comment pep:known_by_projection chromosome:CanFam3.1:35:10854295:10881938:-1 gene:ENSCAFG00000009773 transcript:ENSCAFT00000015519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SWLENLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRV
KLLIGPIQETPSGQDQPTSGLMHQTFGQQKLYQVPNPHSAPRDTIYQVPPSYQHQGIYQV
PTSHGIQEQDVYQVPPSVQRSIGAANGPHLSKKVVTPVRTGQGYVYEYPSRHQKDIYDIP
PSHTTQGVYDIPPSSVKVPVFSLPVGEIKPQGVYDIPPTKGLYAIPPSACRDEAGLREKE
YDFPPPMRQAGRLDVRPEGVYDIPPTSTKPTGKDLHIKYNCDAPGAAELATRRHQSVLLN
HAPSQLGQSPGAQNDAYDVPRGVQFLEPPAETSEKANPEERDGVYDVPLHNPPDAKGSQD
VVDGMNRLSFSSTGSTRSNMSTSSTTSKESSVSASPSQDKRLLLDPDTAIERLHRLQQTL
EVGVSSLMALVTTDWRCYGYMDRHINEIRTSVDKVELFVRDYLHFARGAVANASCLPELT
LHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAVNKPQNKCDDLDRFVMVAKTVPD
DAKQLTTTINTNAEALFRPGPGSSHVKSGSENIMNSTEYPHAASQMPLLHPGDHKAQGLN
KPLPPSLGKDQPPDCSSSDGSERSWMDDYDYVHLQGKEEFERQQKELLEKENIIKQNKLQ
LEHHQLSQFQLLEQEITKPVENDISKWKPSQSLPTTNSSVGAQDRQLLCFYYDQCETHYI
SLLNAIDALFSCVSSAQPPRIFVAHSKFVILSAHKLVFIGDTLTRQVAAQDIRHKVMNSS
NQLCEQLKTIVMATKMAALHYPSTTALQEMVHQVTDLSRNAQLFKRSLLEMATF
Download sequence
Identical sequences F1PBC4
ENSCAFP00000040292 ENSCAFP00000014358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]