SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014526 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014526
Domain Number 1 Region: 290-581
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.63e-75
Family WD40-repeat 0.0000000000293
Further Details:      
 
Domain Number 2 Region: 173-287
Classification Level Classification E-value
Superfamily F-box domain 4.06e-31
Family F-box domain 0.000000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014526   Gene: ENSCAFG00000009879   Transcript: ENSCAFT00000015696
Sequence length 605
Comment pep:known_by_projection chromosome:CanFam3.1:28:13988517:14172176:1 gene:ENSCAFG00000009879 transcript:ENSCAFT00000015696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDC
NNGEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLASTAMKTENCVAKTKLANGTSSMIV
PKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDF
ITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWR
GLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRS
ETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGS
SDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRR
VLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVV
SGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPR
APAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTY
TYISR
Download sequence
Identical sequences E2RDC4 G1T991
ENSCAFP00000014526 XP_002718711.1.1745 XP_003994389.1.62641 XP_004268522.1.21590 XP_004749506.1.14098 XP_007080242.1.5354 XP_007187377.1.59432 XP_008706441.1.72690 XP_011377172.1.92234 XP_012624718.1.48125 XP_014918516.1.86478 XP_015975522.1.101085 XP_019314747.1.44245 XP_019795398.1.83887 XP_021555398.1.83697 XP_543980.3.84170 9615.ENSCAFP00000014526 ENSOCUP00000013190 ENSCAFP00000014526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]