SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014580 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014580
Domain Number 1 Region: 118-241
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-27
Family Third domain of FERM 0.0051
Further Details:      
 
Domain Number 2 Region: 19-115
Classification Level Classification E-value
Superfamily Second domain of FERM 5.36e-24
Family Second domain of FERM 0.0011
Further Details:      
 
Domain Number 3 Region: 316-365
Classification Level Classification E-value
Superfamily RING/U-box 0.00000177
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014580   Gene: ENSCAFG00000009903   Transcript: ENSCAFT00000015751
Sequence length 380
Comment pep:known_by_projection chromosome:CanFam3.1:35:15257359:15276953:1 gene:ENSCAFG00000009903 transcript:ENSCAFT00000015751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHIKETLLAGHLQCSPEQAVELCALLAQ
TKFGDYNQNTAKYSYEELCAKELSSTTLNSIVAKHKELEGTSQASAEYQVLQIVSAMENY
GIEWHSVRDSEGQKLLIGVGPEGISICKDDFCPINRIAYPVVQMATQSGKNVYLTVTKES
GNSVVLLFKMISTRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDLKGHLASLFLNENI
NLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRSDHSPPNSPLKSSESSMNCTSCEG
LSCQQTRALQEKLRKLKEAMLCMVCCEEEIDSTFCPCGHTVCCEGCAAQLQSCPVCRSRV
EHVQHVYLPTHTSLLNLTVI
Download sequence
Identical sequences E2RBJ3
ENSCAFP00000014580 ENSCAFP00000014580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]