SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014654 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014654
Domain Number 1 Region: 316-564
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.94e-99
Family STAT DNA-binding domain 0.0000000403
Further Details:      
 
Domain Number 2 Region: 136-316
Classification Level Classification E-value
Superfamily STAT 6.08e-59
Family STAT 0.00000872
Further Details:      
 
Domain Number 3 Region: 1-121
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 9.29e-44
Family Transcription factor STAT-4 N-domain 0.000000386
Further Details:      
 
Domain Number 4 Region: 565-701
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-43
Family SH2 domain 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014654   Gene: ENSCAFG00000009797   Transcript: ENSCAFT00000015834
Sequence length 748
Comment pep:known_by_projection chromosome:CanFam3.1:37:1566395:1663231:-1 gene:ENSCAFG00000009797 transcript:ENSCAFT00000015834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQGDKNNALMNQEVLTLQEMLNSLDFKRKEALSKMTQIVNETDLLMNSMLMEELQDWKR
RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRAHL
LERVTFLIYNLFKNSFVVERQPCMPTHPQRPMVLKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNVSTLSNRRFVLCGTHVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGSKGNEGCH
MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL
VFFNNPPSATLSQLLEVMSWQFSSYVGRGLNSDQLNMLAEKLTAQSSYNDGHLTWAKFCK
EHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDHSENGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY
LYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSAEPHSPSDLLPM
SPSVYAVLRENLSPATIETAMKSPYSAE
Download sequence
Identical sequences E2RLW2
ENSCAFP00000014654 XP_005640526.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]