SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014777 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014777
Domain Number 1 Region: 6-229
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 9.81e-44
Family Galactose oxidase, central domain 0.0052
Further Details:      
 
Domain Number 2 Region: 243-344
Classification Level Classification E-value
Superfamily Kelch motif 4.97e-18
Family Kelch motif 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014777   Gene: ENSCAFG00000010046   Transcript: ENSCAFT00000015976
Sequence length 350
Comment pep:known_by_projection chromosome:CanFam3.1:38:1833591:1839117:-1 gene:ENSCAFG00000010046 transcript:ENSCAFT00000015976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPSVKDFQWKRLAPLPSRRVYCSLLESGGQVYAIGGCDDSGVPVDCFEVYSPEADRWT
ALPRLPTARAGVAATALGKRIMVIGGVGTSQLPLKVVEMYNIDEGKWKRRSVLREAAMGI
SVTAKDYRVYAAGGMGLDLRPHNHLQHYDMLKDMWVSLAPMPTPRYAATSFLRGSKIYVL
GGRQSKYAVNAFEVFDIETRSWTKFPNIPCKRAFSSFVTLDDRLYSLGGLRQARLYRQPK
FLRTMDVFDMEQGGWLKMERSFFLKKRRADFVAGSLSGRVIVAGGLGNQPTVLETAEAFH
PGKNKWEVLPPMPTPRCACSSIVIKNCLLAVGGVNQGLSDTVEALCVSDS
Download sequence
Identical sequences E2RG20
ENSCAFP00000014777 XP_545688.1.84170 9615.ENSCAFP00000014777 ENSCAFP00000014777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]