SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014882 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014882
Domain Number 1 Region: 77-411
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-82
Family Protein kinases, catalytic subunit 0.0000047
Further Details:      
 
Domain Number 2 Region: 1376-1441
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Domain Number 3 Region: 1459-1591
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000104
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000014882
Domain Number - Region: 616-795
Classification Level Classification E-value
Superfamily Tropomyosin 0.000785
Family Tropomyosin 0.0014
Further Details:      
 
Domain Number - Region: 447-612
Classification Level Classification E-value
Superfamily Tropomyosin 0.0595
Family Tropomyosin 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014882   Gene: ENSCAFG00000010114   Transcript: ENSCAFT00000016092
Sequence length 2053
Comment pep:known_by_projection chromosome:CanFam3.1:26:15719698:15884090:-1 gene:ENSCAFG00000010114 transcript:ENSCAFT00000016092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKFKYGARNQMDAGAAEPIASRASRLNHFFQGKPPFLTQQQMSPLSREGILDALFVLFG
ECSQPALMKIKHVSNFVRKYSDTIAELQELQPSAKDFEVRSLVGCGHFAEVQVVRERATG
DIYAMKVMKKKTLLAQEQVSFFEEERNILSQSMSPWIPQLQYAFQDKNNLYLVMEYQPGG
DLLSLLNRYEDQLDENMIQFYLAELILAVHSIHQMGYVHRDIKPENILIDRTGHIKLVDF
GSAAKMNSNKMVSAKLPIGTPDYMAPEVLTVMNGDGKGIYSLDCDWWSVGVIAYEMVYGR
SPFTEGTSARTFSNIMNFQRFLKFPDDPKVSGELLDLIQSLLCGQRERLKFEGLCCHPFF
SKIDWNNIRNSPPPFVPTLKSDDDTSNFDEPEKNSWVSSSPRQLNLSGFSGEELPFVGFS
YSKALGILGRSESIVSSLDSPAKTSSMEKKLLIKSKELQDSQDKCHKMEQEMTRLHRRVS
EVEAVLSQKEVELKASETQRSLLEQDLATYITECSSLKRSLEQARMEVSQEDDKALQLLH
DIREQSRKLQEIKEQEYQAQVEEMRLMMNQLEEDLVSARRRSDLYESELRESRLAAEEFK
RKATECQHKLMKAKDQGKPEVGEYSKLEKINAEQQLKIQELQEKLEKAVKASTEATELLQ
NIRQAKERAERELEKLQNREDSSEGIKKKLVEAEERRHSLENKVKRLETMERRENRLKDD
IQTKSQQIQQMADKILELEEKHREAQVSAQHLEVHLKQKEQHYEEKIKVLDSQIKKDLAD
KETLENLMQRHEEEAHEKGKILSEQKAMINAMDSKIRSLEQRIVELSEANKLAANSSLFT
QRNMKAQEEMISELRQQKFYLETQAGKLEAQNRKLEEQLEKISHQDHSDKNRLLELETRL
REVSLEHEEQKLELKRQLTELQLSLQERESQLTALQAARAALESQLRQAKTELEETTAEA
EEEIQALTAHRDEIQRKFDALRNSCTVITDLEEQLNQLTEDNAELNNQNFYLSKQLDEAS
GANDEIVQLRSEVDHLRREITEREMQLTSQKQTMEALKTTCTMLEEQVMDLEALNDELLE
KERQWEAWRSVLGDEKSQFECRVRELQRMLDTEKQSRARADQRITESRQVVELAVKEHKA
EILALQQALKEQKLKAESLSDKLNDLEKKHAMLEMNARSLQQKLETERELKQRLLEEQAK
LQQQMDLQKNHIFRLTQGLQEALDRADLLKTERSDLEYQLENIQVLYSHEKVKMEGTISQ
QTKLIDFLQAKMDQPAKKKKVPLQYNELKVALEKEKARCAELEEALQKTRIELRSAREEA
AHRKATDHPHPSTPATARQQIAMSAIVRSPEHQPSAMSLLAPPSSRRKESSTPEEFSRRL
KERMHHNIPHRFNVGLNMRATKCAVCLDTVHFGRQASKCLECQVMCHPKCSTCLPATCGL
PAEYATHFTEAFCRDKMNSPGLQTKEPSSGLHLEGWMKVPRNNKRGQQGWDRKYIVLEGS
KVLIYDNEAREAGQRPVEEFELCLPDGDVSIHGAVGASELANTAKADVPYVLKMESHPHT
TCWPGRTLYLLAPSFPDKQRWVTALESVVAGGRVSREKAEADAKLLGNSLLKLEGDDRLD
MNCTLPFSDQVVLVGTEEGLYALNVLKNSLTHVPGIGAVFQIYIIKDLEKLLMIAGEERA
LCLIDVKKVKQSLAQAHLPAQPDISPNIFEAVKGCHLFAAGKIENGLCICAAMPSKVVIL
RYNENLSKYCIRKEIETSEPCSCIHFTNYSILIGTNKFYEIDMKQYTLEEFLDKNDHSLA
PAVFASSSNSFPVSIVQVNSAGQREEYLLCFHEFGVFVDSYGRRSRTDDLKWSRLPLAFA
YREPYLFVTHFNSLEVIEIQARSSLGTPARAYLEIPNPRYLGPAISSGAIYLASSYQDKL
RVICCKGNLVKESGTDHHRGPSTSRSPNKRGPPTYNEHITKRVASSPAPPEGPGHPREPS
TPHRYREGRTELRRDKSPGRPLEREKSPGRMLSTRRERSPGRLFEDSSRGRLPVGAVRTP
LSQVNKVWDQSSV
Download sequence
Identical sequences E2RPN3
XP_013963441.1.84170 ENSCAFP00000014882 ENSCAFP00000014882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]