SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014945 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014945
Domain Number 1 Region: 80-265
Classification Level Classification E-value
Superfamily RNI-like 1.26e-33
Family Cyclin A/CDK2-associated p19, Skp2 0.012
Further Details:      
 
Domain Number 2 Region: 18-56
Classification Level Classification E-value
Superfamily F-box domain 0.000000144
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014945   Gene: ENSCAFG00000010176   Transcript: ENSCAFT00000016159
Sequence length 300
Comment pep:known chromosome:CanFam3.1:28:14927812:14929722:1 gene:ENSCAFG00000010176 transcript:ENSCAFT00000016159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPMEPSGGEQEPGAVRLLDLPWEDVLLPHILSRVPLRQLLRLQRVSRAFRALVQLHLA
GLRRFDAAQVGPQIPRAALAWLLRDAEGLQELALAPCHEWLSDEDLVPVLTRNPQLRSVA
LAGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLK
DEAIVYLAQRRGAGLRSLSLAVNANVGDAAVQELARNCPELEHLDLTGCLRVGSDGVRTL
AEYCPALRSLRVRHCHHVAEPSLSRLRKRGVDIDVEPPLHQALVLLQDMAGFAPFVNLQV
Download sequence
Identical sequences E2RKN7
ENSCAFP00000014945 9615.ENSCAFP00000014945 XP_013964418.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]