SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014977 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014977
Domain Number 1 Region: 228-330
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000192
Family F-box domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014977   Gene: ENSCAFG00000010195   Transcript: ENSCAFT00000016193
Sequence length 367
Comment pep:known_by_projection chromosome:CanFam3.1:25:37429763:37475450:1 gene:ENSCAFG00000010195 transcript:ENSCAFT00000016193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFLGQDWRSPGWSWIKTEDGWKRCESWSRDLDRENNPCNVSHSIILNSDDEEIFSNEEQ
KYTSKKRKKDHFRNDTNTQCFYREKWIYVHKESTRERHGYCTLGEAFNRLDFSSAIQDIR
RFTYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHQNPRLIKDLLQDLSSTL
CILIRGVGKSVLVGNINIWICRLETILRWQQQLQNLQVTKQVNDGLTLSDLPLHMLNNIL
YRFSDGWDIVTLGQVTPTLSVLSEDRQLWKRLCQYHFAEQQFCRHLILSEKGHVEWKLMY
FALQKHYPPREQYGDTLHFCRHCSILFWKDCRLALLFKDSGHPCTAADPDSCFMPVSPQH
FIDLFKF
Download sequence
Identical sequences E2RJQ5
ENSCAFP00000014977 ENSCAFP00000014977 XP_013963035.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]