SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015092 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015092
Domain Number 1 Region: 112-189,289-355,390-535
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 9.06e-86
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000496
Further Details:      
 
Domain Number 2 Region: 573-717
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.000000000883
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0043
Further Details:      
 
Domain Number 3 Region: 25-77
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000018
Family Glutathione S-transferase (GST), C-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015092   Gene: ENSCAFG00000010271   Transcript: ENSCAFT00000016316
Sequence length 831
Comment pep:known_by_projection chromosome:CanFam3.1:18:46956515:47007511:-1 gene:ENSCAFG00000010271 transcript:ENSCAFT00000016316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSSGEQAPAYRSILSISDEAARVQALNEHLSTRSYVRGYSLSQADVDAFRQLSAPPAD
TRLFHVARWFRHIEAILGGPCARGEPCGRQASKSRRGQPQWSPPAGSPPCKLRLYNSLTR
NKDVFIPQHGKKVTWYCCGPTVYDASHMGHARSYISFDILRRVLRDYFGYDVFYCMNITD
VDDKIIKRARQNYLFEEYREKQPRAAQLLEDVHAALKLFSVKLQETTDPDKKHMLERIQH
TVQLAAEPLERAVQNDLPAEVADSCAEVLLEEAKDLLSDWLDSTLGSEVTDNSIFSKLPK
FWEEEFHKDMEALNVLPPDVLTRVSEYVPEIVNFVQKIVDNGYGYASNGSVYFDTVKFAS
SERHSYGKLVPEAVGDQKALQEGEGDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPW
GKGRPGWHIECSAMAGTLLGASMDIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHT
GHLTIAGCKMSKSLKNFITIKDALKKHSARQLRLAFLMHSWKDTLDYSSNTMESALQYEK
FMNEFFLNVKDLLRAPVDISGRFEKWEDEESELNKSFYDKKAAVHEALCDNVDTRTVLEE
MRALVSQCNLYMATRKAARRRPNRALLESIALYLTRMLKIFGAIEEESSLGFPVRGPGTS
PDLESTVMPYLQVLSEFREGVRKIAREQKVPEVLQLSDALRDDILPELGVRLEDHEGLPT
VVKLGDREALLREREEKRRVEEEKRKKKEEAARIKQEQEAAKLAKMKIPPSEMFLSESDK
YSKFDENGLPTHDVDGKELSKGQAKKVKKLYEAQEKRHKEYLQMAQNGSLK
Download sequence
Identical sequences F1PU34
XP_851224.1.84170 ENSCAFP00000015092 ENSCAFP00000015092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]