SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015158 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015158
Domain Number 1 Region: 74-285
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-24
Family Pleckstrin-homology domain (PH domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 898-975,1015-1104,1155-1196,1447-1591,2091-2138
Classification Level Classification E-value
Superfamily ARM repeat 0.0000358
Family Armadillo repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015158   Gene: ENSCAFG00000010292   Transcript: ENSCAFT00000016386
Sequence length 2181
Comment pep:known_by_projection chromosome:CanFam3.1:25:37963297:38125086:-1 gene:ENSCAFG00000010292 transcript:ENSCAFT00000016386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFRGKVFKRESSEFRKKRRTVRRTNQEEIHKFSSQEKPRLLEPLDYETVIEELEKTYRN
DPLRDLLFFPSDDFSTATVSWDIRTLYSTVPEDAEHKAENLLVKEACKFYSSQWHVVNYK
YEQYSGDIRQLPRRAEYKPEKLPSHSFEVDHEDADKDEDTTSHSSSKGGGGAGGTGVFKS
GWLYKGNFNSTVNNTVTVRSFKKRYFQLTQLPDNSYIMNFYKDEKISKEPKGCIFLDSCT
GVVQNNRLRKYAFELKMNDLTYFVLAAETESDMDEWIHTLNRILQISPEGPSQGRRSTEL
ADLGLASLPLKILIRSRQREESKREDSLHPDFAKYLTETEETVKTTRNMERLNLFSLDPD
IDTLKLQKKDLLETDSGIKPFEEKAAKRIMIICKALNLNLQGCVTENENDPITNIEPFFV
SVALYDLRESRKISADFHVDLNHTAVRQMLSGASVALENGNIDTVTPRQSEEPHIKGFPE
EWLKFPKQAIFSVSNPHSEIVLVAKIEKVLMGNIASGAEPYIKNPDSNKYAQKILKSNRQ
FFSKLGKYRMPFAWAVRSVFKDNQGSVDRDSRFSPLYRQESSKISTEDLLKLVSDYRRVD
RISKTQTIPGSLDIAVDNVPLEHPNCVTSSFIPVKPFDVTAQPEPTVEVEEFVYDSTKYC
RPYRVYKNQIYIYPKHLKYDSQKCFNKARNITVCIEFKNSDEEGAKPVKCIYGKPGGPLF
TSAAHTAVLHHSQNPDFSDEVKIELPTQLHEKHHILFSFYHVTCDINAKANAKKKEMLET
SVGYAWLPLMKHDQIASQEYNIPIATGLPPNYLSFQDSASGKHGGSDIKWVDGGKPLFKV
STFVVSTVNTQDPHVNAFFRQCQKREKDMSQSPTSNFIRSCKNLLNVEKIHAIMSFLPII
LNQLFKVLVQNEEDEITTTVTRVLTDIVAKCHEEQLDHSVQSYIKFVFKTRACKERTIHE
ELAKNVTGLLKSNDSTTVKHVLKHSWFFFAIILKSMAQHLIDTNKIQLSRAQRFPESYQN
ELDNLVMVLCDHVIWKYKDSLEETRRANHSVAKFLKRCFTFMDRGYVFKMVNNYISMFSS
GDLKTLCQYKFDFLQEVCQHEHFIPLCLPIRSANIPDPLTPSESTQELHASDMPEYSVTN
EFCRKHFLIGILLREVGFALQEDQDIRHLALAVLKNLMAKHSFDDRYREPEKQAQIASLY
MPLYGMLLDNMPRIYLKDLYPFTVNTSNQGSRDDLSTNGGFHTQSAMKHANSVDTSFSKD
VLNSIAAFSSIAISAVNHADSRASLASLDSNPSTNEKSSEKTDNCEKIPRPLSLIGSTLR
FDKLDQAETRSLLMCFLHIMKTISEETLIAYWQRAPSPEVSDFFSILDVCLQNFRYLGKR
NIIRKIAAAFKFVQSTQNNGTLKGSNPSCQTSGPLSQWMHTTSTHEGHKQHRSQTLPIIR
GKNALSNPKLLQMLDNTMSSNSNEIDIVHHVDTEANIATEVCLTILDLLSLFTQIHQRQL
QQSECQNSMMKRVFDTYMLFFQVNQSATALKHVFASLRLFVCKFPSAFFQGPADLCGSFC
YEVLKCCNHRSRSTQTEASALLYFFMRKNFEFNKQKSIVRSHLQLIKAVSQLIADAGIGG
SRFQHSLAITNNFANGDKQMKNSNFPAEVKDLTKRIRTVLMATAQMKEHEKDPEMLVDLQ
YSLANSYASTPELRRTWLESMAKIHARNGDLSEAAMCYIHIAALIAEYLKRKGYWKMEKI
CTPSLLPEDIHPCDSYPLLTAPGGGSMFSMGWPAFLSITPNIKEEGAMKEDSGMQDTPYN
EHILVEQLYMCVEFLWKSERYELIADVNKPIIAVFEKQRDFKKLSELYYDIHRSYLKVAE
VVNSEKRLFGRYYRVAFYGQGFFEEEEGKEYIYKEPKLTGLSEISQRLLKLYADKFGADN
VKIIQDSNKVNPKDLDPKYAYIQVTYVTPFFEEKEIEDRKTDFEMHHNINRFVFETPFTL
SGKKHGGVEEQCKRRTVLTTSHLFPYVKKRIQVISQSSTELNPIEVAIDEMSKKVSELNQ
LCTMEEVDMIRLQLKVQGSVSVKVNAGPMAYARAFLEETNAKRYPDNQVKLLKEIFRQFA
DACGQALDVNERLIKEDQLEYQEELRSHYKDMLSELSTIMNEQIMCRDDPSKRGAERTCP
PVVSRAPPALPTVSISPSDEV
Download sequence
Identical sequences F1PSB3
ENSCAFP00000015158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]