SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015188 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015188
Domain Number 1 Region: 134-187
Classification Level Classification E-value
Superfamily F-box domain 0.00000556
Family F-box domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015188   Gene: ENSCAFG00000010330   Transcript: ENSCAFT00000016418
Sequence length 376
Comment pep:known_by_projection chromosome:CanFam3.1:7:164919:180583:-1 gene:ENSCAFG00000010330 transcript:ENSCAFT00000016418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGPGPLGRPHPDSVAMPKRGKRLKFRAHDACSGRVTVADYANSDPAVVRSGRVKKAVA
NAVQQEVKSLCGLEASQVPAVEALSGVGEPCDVIDSSDEMDAQEESVHERTISRKKKSKR
HKEDLDGAGGEEYPMDIWLLLASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTL
DASLPLRLRPESMEKLRCLRACVIRSLYHMYEPFAARISKNPAIPESTPSTLKNSKCLLF
WCRKIVGNRQEPMWEFNFKFKKQSPRLKSKCMGGLQPPIQYEDVHTNPDQDCCLLQVTTL
NFIFIPIVMGMIFTLFTINVSTDMRHHRVRLVFQDSPVHGGRKLRSEQGVQVILDPVHSV
RLFDWWHPQYPFSLRA
Download sequence
Identical sequences E2RJ33
XP_537117.3.84170 ENSCAFP00000015188 ENSCAFP00000015188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]