SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015268 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015268
Domain Number 1 Region: 369-534
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-56
Family Phosphotyrosine-binding domain (PTB) 0.000000232
Further Details:      
 
Domain Number 2 Region: 548-671
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.0000769
Further Details:      
 
Domain Number 3 Region: 663-745
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000263
Family PDZ domain 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015268   Gene: ENSCAFG00000010382   Transcript: ENSCAFT00000016503
Sequence length 754
Comment pep:known_by_projection chromosome:CanFam3.1:3:38243102:38431511:1 gene:ENSCAFG00000010382 transcript:ENSCAFT00000016503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRKRQSTASGTLEHRARPGPAPHGPEPGGGEAELPPEEYVPERLELAALRPESPAPPD
QGCHDHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGITYYIRYCPEDDSYLEGMDCNGEG
YLAHGPRHLETDECQEAVEEWTDSAGPHPHGPADGGSPDYRDGHLPVPEDEASALEAQDQ
EEGVHYCPSEEGYQDYYPTEANGNAGGASPYRPRRGDGDLEDQEEDIDQIVAEIKMSLSM
TSITSAGEASPEHTLVRGPEPGPGGSTETCPPCEASHGPSRHEGRPKSLNLPPEAKHSGD
PQRGFKTKSRTPEERAKWPQEQVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVASFPSFV
AVPGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKK
KANSEGDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRM
PRSASQDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINP
EDLSQKEYSDIINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTV
ILANMMNGGPAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCP
PVTTVLIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEK
IVQALSNSVGEIHMKTMPAAMFRLLTGQETPLYI
Download sequence
Identical sequences F1PP27
ENSCAFP00000015268 ENSCAFP00000015268 XP_005618333.1.84170 XP_848698.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]